(data stored in ACNUC7421 zone)

EMBL: CP001622.PE436

CP001622.PE436       Location/Qualifiers
FT   CDS_pept        complement(454134..455216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0439"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: ret:RHE_CH00762
FT                   GDP-mannose 4,6-dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54748"
FT                   /db_xref="GOA:C6B1M9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M9"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACS54748.1"
FT                   /translation="MKRALITGITGQDGSYLAELLIEKGYEVHGIKRRTSLFNTDRIDH
FT                   LYQDPHDTNRRLVLHYGDMTDSSSLVRIVQQVQPDEIYNLAAQSHVAVSFEEPEYTANS
FT                   DALGALRILEAIRILGLEKKTRFYQASTSELYGLVQEIPQRETTPFYPRSPYAVAKLYA
FT                   YWITVNYREAYGIYACNGILFNHESPVRGETFVTRKITRALARIKLGLQDCLYLGNLDA
FT                   KRDWGHAKDYVEMQWLMLQQDEPEDFVIATGVQYSVREFVDAAAHEIGLPISWKGSGAE
FT                   EKGYDENGRCIVAVDPRYFRPTEVETLLGDPSKAKEKLGWEPRITFKQLVEEMMREDLK
FT                   SAERDELVKRHGFSAYDYHE"
     atgaaaagag ccctcatcac aggcatcacg ggccaggacg gctcctatct tgcagagctt        60
     ctcatcgaga agggatatga ggtacacggc atcaagcgcc gcacgtccct cttcaatacc       120
     gaccgcatcg accacctcta ccaggatcca cacgacacca accgcaggct tgtgctgcac       180
     tacggggaca tgacggattc atcgagcctc gttcgcatcg tccagcaggt ccagcccgac       240
     gagatctata acctcgcggc acagtcgcat gtcgccgtct cattcgaaga gccggaatat       300
     acggccaatt ccgacgcgct cggcgcgctg cgcatcctcg aggcgatccg cattctcggc       360
     cttgagaaga agacgcgttt ctaccaggcg tccacctccg aactctacgg cctggtgcag       420
     gaaatcccgc aacgcgaaac gacccctttc tatccgcgct cgccttacgc tgtcgccaaa       480
     ctctacgcct actggatcac ggttaactat cgggaagcct atggcattta tgcctgcaac       540
     ggcatcctct tcaaccacga gagccccgtg cggggcgaga cctttgtgac gcgcaagatc       600
     acccgtgcac tggcgcgcat caagcttggc cttcaggact gcctctatct cggcaacctg       660
     gacgcaaagc gtgactgggg gcatgccaaa gactatgtcg agatgcaatg gctgatgctg       720
     cagcaggacg agccggagga tttcgtcatc gccactggcg tgcagtacag cgtccgcgaa       780
     ttcgtcgacg ccgcggccca tgagattggg cttccaatct catggaaagg atcaggcgcc       840
     gaggaaaaag gctacgacga gaacggccgc tgcatcgtcg cggtcgaccc ccgatacttc       900
     cgtcccacag aggtcgagac cctgctgggc gatccgtcga aggcgaagga aaagctcggt       960
     tgggaaccaa ggataacgtt taagcagctt gttgaggaaa tgatgcgcga ggatcttaag      1020
     tccgccgagc gggacgaact cgtgaaacgc cacggcttct ccgcatacga ctatcacgag      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page