(data stored in ACNUC7421 zone)

EMBL: CP001622.PE437

CP001622.PE437       Location/Qualifiers
FT   CDS_pept        455861..456889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0440"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: rpe:RPE_4236 N-acetylneuraminate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54749"
FT                   /db_xref="GOA:C6B1N0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N0"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ACS54749.1"
FT                   /translation="MFRKDVLDESPFVIAEVGQNHQGDLDIAREYIRIYAFEGADAIKF
FT                   QTRNNRYLFSEDAYAAGYDSENAFAETYGAHREKLELKPEWLPILKADCEKHGVKFMST
FT                   PFDEPSLEILQQIDVDLLKVASFDLGNLPFLNRIAKLGKPVVMSIGGGKIEQIRSSVEV
FT                   VLRHHDQLAILHCVSEYPCEYNRLGLDNIEVLIKEFPDCIIGSSDHFNGTLSGPIAYMK
FT                   GARVFEKHVTLNRAWKGTDHSFALEPDGFRKFVRDIKRVRAMMPQKPADEIGNERVFKK
FT                   LGKSIIAYSDIRVGEELTLDKLSGRIFNTHYIPVRESNKVLGKTVKRDIAKGEPIQYSD
FT                   FG"
     atgtttcgca aagatgttct cgatgaatcg cccttcgtga ttgccgaagt gggccaaaat        60
     catcagggag acctggatat cgcccgagaa tatatccgaa tttatgcatt cgaaggcgcg       120
     gatgcgatca agtttcagac gcgcaacaat aggtaccttt tttcggagga tgcttatgcg       180
     gcggggtatg acagcgaaaa tgcttttgca gaaacctacg gcgctcatcg agagaagctc       240
     gagctaaaac cggaatggct gcccattctg aaggctgatt gcgaaaagca cggcgtgaag       300
     ttcatgtcga cacccttcga cgagccaagc ctcgagatcc tccagcagat tgatgtcgac       360
     ctgttgaaag tggcttcgtt cgatcttggc aaccttccct tcctcaatcg gatcgcgaaa       420
     ctcggtaagc ccgttgtcat gagcattggc ggcggcaaga tcgaacagat ccggtccagc       480
     gtcgaggtgg tgttgaggca tcacgatcag ttggccatcc tgcactgcgt ctccgaatat       540
     ccgtgcgagt acaaccgcct tgggctggac aatattgagg ttctcatcaa ggagtttccg       600
     gattgtatca tcggctcgtc cgatcacttc aacgggacct tgtcaggccc gattgcctac       660
     atgaagggcg cgcgcgtgtt cgaaaagcac gttaccctca accgcgcctg gaagggcacc       720
     gaccatagct ttgcactgga gcctgacggc ttccgcaagt tcgtgcgtga catcaagcgc       780
     gtccgcgcga tgatgcctca gaagccggcg gacgagatcg gcaacgaaag agtgttcaag       840
     aagctgggca agtcgatcat cgcatattcg gacatccgcg tcggcgaaga gctgaccctg       900
     gataagcttt cgggtcgcat tttcaatacc cattacatac ctgtgcggga gagcaataag       960
     gttctcggaa agacggtgaa gcgggatatt gcaaagggtg aacccattca atactccgat      1020
     ttcggctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page