(data stored in ACNUC7421 zone)

EMBL: CP001622.PE438

CP001622.PE438       Location/Qualifiers
FT   CDS_pept        457037..457849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0441"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rce:RC1_3770 oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54750"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54750.1"
FT                   /translation="MNVDGIFDVSGDVVLVTGVSGQLGGEYAKAFLARNARVVGLDLRP
FT                   SAGSLVMQDEYPDNFMFCSADVTKKASLEQALQDVTGRFGTPTVLINNAAIDSPPSAPP
FT                   EENGPFEDYPEASWDKVIDVNLKGVYLSCQVFGAAMANAGKGSIINVASIYGLVSPDQS
FT                   LYEYRRKRGEVFFKPVAYSASKSGILNLTRYLATYWAKRNVRVNSLTIAGVFNNQEQDF
FT                   LDVYCSRIPIGRMASVDEYNGAMLFLASPASRYMTGSNLIIDGGWTAI"
     atgaatgtcg atggaatttt tgacgtgagt ggcgacgtcg tccttgtaac cggtgtttcc        60
     ggccaactgg gcggcgagta cgccaaggct tttcttgcgc gcaatgcgcg tgttgttggc       120
     ctcgatctcc gtccctctgc cggcagcctc gtgatgcagg acgaataccc cgacaatttc       180
     atgttttgtt cggcggatgt aaccaagaag gcgtcattgg agcaggcgct tcaggacgtg       240
     accggtagat tcggtacgcc caccgtcctc atcaacaatg ccgctatcga ttctccgcct       300
     tccgccccgc ccgaggaaaa cggcccgttt gaagactacc cggaagcgtc ttgggacaag       360
     gttatcgacg tgaacctcaa gggcgtctat ctctcatgcc aggtattcgg cgccgcgatg       420
     gctaatgccg gcaagggatc aatcatcaac gtcgcttcca tttatgggct cgtttctccc       480
     gaccagagcc tctacgaata tcgccgaaag cgcggagagg tcttcttcaa acccgtggcc       540
     tattcagcat cgaaatccgg tatcctgaat ctgacgcgat acctggcgac ttattgggcg       600
     aagcgcaacg tgcgcgtaaa ctcgctcacg atcgcgggcg tctttaacaa ccaggagcag       660
     gacttcctcg atgtctactg cagccggatc ccgatcggtc gtatggcgag cgtcgatgaa       720
     tacaacggcg ctatgttatt cttggcgagc cctgcatccc gatatatgac gggctctaat       780
     ctcatcatcg acggcggctg gacggcaatc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page