(data stored in ACNUC7421 zone)

EMBL: CP001622.PE439

CP001622.PE439       Location/Qualifiers
FT   CDS_pept        457852..459312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0442"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rce:RC1_3767
FT                   aldehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54751"
FT                   /db_xref="GOA:C6B1N2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACS54751.1"
FT                   /translation="MTTLRILNWINGQASHASSEGWLEKFNPHSGELLYHVADSSQDDV
FT                   EQAITAARSAFPAWAELTPVKRGQILMDIVALMKRRSDELAECIALETGKPPQDAKGET
FT                   GGAIMQAEYFAGEGMRLYARSLTSGTPGKYSHTVRQPRGVAGLIVPANTPIANIAWKTF
FT                   PALICGNTVVLKAAEDSPRIAQLFAELTKEAGLPDGVFNVVHGRGEPAGSTLVTDERVD
FT                   IISFTGSTGVGRRIAEVAGKRLARISLELGGKNPFVVCDDADLDQAVHWAALSAFSNAG
FT                   QRCAAGSRMLVFKSVYEEFRDRLTAKARSLKLGVAAGCDLGPLVSLRQQQSVLSAIERA
FT                   KEQGGQVLCGGRTPDAPELAGGYYVEPTVIDGLATTSDLSCKEVFGPVTTLHPVGSMTE
FT                   ALDVANATEYGLTAAVHTRNVDRAMWFAQRVKAGVANVNMGTYGSEPHMPFGGFGSSGN
FT                   GTREPGVEALDVYSELKNISFLVRPGML"
     atgacgacgc ttcgcattct caattggatc aacggccagg ccagccacgc ctcgagtgaa        60
     ggatggcttg agaaattcaa tccgcacagt ggcgaactcc tttatcacgt ggctgactcc       120
     tcgcaggatg atgttgagca agcaataacg gcagcgcgtt cggcgttccc agcctgggcg       180
     gagcttacac ccgtaaagcg cggccagatt ctgatggata tcgtcgccct gatgaagcga       240
     cgttccgatg agctggcgga atgcattgcg cttgaaaccg gcaaacctcc ccaggacgcc       300
     aaaggcgaga cgggcggagc gatcatgcag gcggaatatt tcgccggcga gggtatgcgc       360
     ctatacgccc ggtcgctcac ctcaggcacg cccggcaaat acagccacac agtgcgccaa       420
     cctcgtggcg tagccggtct gatcgtgccg gcaaatacgc cgatcgccaa tatcgcatgg       480
     aagacttttc ctgcgcttat ttgcggcaac acggtggttc tgaaagctgc cgaggactct       540
     ccacgcatag cccaactctt tgccgagctg accaaggagg cgggattgcc cgacggcgta       600
     ttcaacgtcg tacatgggcg tggcgagccg gctggctcga cgttggtcac agacgagcgg       660
     gtcgacatta tcagcttcac gggctcgacc ggagtaggcc gcaggattgc ggaagtcgct       720
     ggaaagcgtc tcgcacgtat ttctctcgaa ctgggcggca agaacccctt cgtcgtctgt       780
     gatgacgccg atctcgatca ggcggtgcac tgggcggcgc tgtcggcctt cagcaatgcc       840
     ggccagcgct gcgccgcagg tagccgcatg ctggtgttta aatcggtcta cgaggagttt       900
     cgggaccgac tgaccgcaaa ggccagaagc ctcaagctag gtgttgccgc cggatgcgat       960
     ctcgggccgc tcgtcagcct ccgccaacag cagtccgtgc tttccgccat cgaacgcgca      1020
     aaagaacaag gcggccaggt gctttgcggg gggcgcacac cggacgcacc ggagttggcc      1080
     ggaggctatt atgtcgagcc tacagttatc gatggccttg ccaccacgtc ggatctcagt      1140
     tgcaaggaag tcttcggtcc ggtgacgaca ctccatcccg tcggcagcat gaccgaggcg      1200
     ctggatgtag caaacgccac cgaatacgga ttgaccgctg ctgtgcatac ccgcaacgtc      1260
     gatcgcgcga tgtggttcgc ccaaagggtc aaagccggcg tcgccaatgt caacatgggt      1320
     acgtatggca gcgagccgca catgccgttc ggcggcttcg ggtcgtccgg gaatggcacg      1380
     cgcgagcctg gagtcgaggc gctcgatgtg tattcggaac tgaaaaacat ctccttcctt      1440
     gtccgcccgg ggatgctttg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page