(data stored in ACNUC7421 zone)

EMBL: CP001622.PE44

CP001622.PE44        Location/Qualifiers
FT   CDS_pept        complement(40307..43213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0045"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: rec:RHECIAT_CH0000427 [protein-PII]
FT                   uridylyltransferase protein; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: GlnD PII-uridylyltransferase;
FT                   metal-dependent phosphohydrolase HD sub domain; amino
FT                   acid-binding ACT domain protein; DNA polymerase beta domain
FT                   protein region; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54356"
FT                   /db_xref="GOA:C6AYD2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD2"
FT                   /inference="protein motif:TFAM:TIGR01693"
FT                   /protein_id="ACS54356.1"
FT                   /translation="MQTKQAAGREPAVRHEQETAPAIAMRDLDFSNILDVELLQKQCDA
FT                   VAEANRNRPDVLRADLLAVLKKASTEGRQKAREALMADGGGLNCAYRISWLQDQITTVL
FT                   YNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFLPRPAEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRYICGLQRLETELESRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LIKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRNRKIAGSVE
FT                   FVEDRGRIALADPEVFKRDPVNIIRLFHVADINGLEFHPDALKRVTRSLALIDTSLREN
FT                   DEANRLFMSILTSKRDPALILRRMNEAGVLGRFIPEFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDILSEIDKGRAEDLHPLANKLMPGIEDREALYVAVLLHDIAKGRQEDHSIAGARVA
FT                   RKLCARFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALHSALA
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQIRHAHFIRQSDKAGQALATTVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFTDDADELRRAA
FT                   TIGRMIEDVLSGRKRLPEVIATRARNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTPPAAEKKAGSPI"
     atgcagacga aacaagcggc aggccgtgaa ccggcagtcc ggcatgaaca ggaaaccgcc        60
     ccggcgatag cgatgcgcga cctcgatttc tccaatatcc tcgacgtcga gctcttgcag       120
     aagcagtgtg acgccgttgc cgaggccaac cgcaaccggc ccgacgtcct gcgcgccgat       180
     cttctggcgg tgctgaagaa ggcgagcacc gaaggccggc agaaggcgcg cgaggcactg       240
     atggccgacg gcggcgggct caattgcgcc taccggattt cctggctgca ggaccagatc       300
     accaccgtcc tctacaattt cgccaccgcc catatctttc cgcagcagaa ggacaagttc       360
     gcggtcaccg ccgtcggcgg ctacggccgc gacacgctgg cgccgggctc cgatatcgac       420
     ctgctgtttc tctttctgcc gaggccggcg gaagagacgc acaaagcggt cgaattcatg       480
     ctctacgtgc tctgggacat gggcttcaag gtcggtcacg ccacccgcac ggtggaggaa       540
     tgcattgcgc tttccaagtc cgacatgacg atccgcaccg ccatcctgga gatgcgctac       600
     atctgcggcc tgcagcggct ggaaaccgag ctcgagtccc gcttcgacaa ggagatcgtc       660
     accggcaccg ggccggaatt catcgccgcc aagcttgccg agcgcgacga gcgccaccgc       720
     aaggcgggcg acacgcgtta tctcgtcgag ccgaacgtca aggaaggcaa aggcgggctc       780
     cgcgacctgc acacgctgtt ctggatctcg aaatattatt atcacgtgcg cgaccaggcg       840
     gaactgatca agctcggcgt gctgtccaag cacgagtacc gcctgcttga gaaagccgac       900
     gactttctct gggcggtgcg ctgccatatg catttcctga ccggcaaggc cgaggaacgt       960
     ctgtcgttcg atatccaacg cgagatcgcc gaagccttcg gctatcacac ccgcccgggc      1020
     ctttcggccg tcgagcgctt catgaaacac tatttcctcg tcgccaagga tgtcggcgat      1080
     ctcacgcgca tcctttgcgc cgcgcttgaa gaccagcagg cgaagtcgat cccgggcctc      1140
     accggcgtca tcagccgctt cacccatcgc aaccgcaaga tcgccggcag cgtcgaattc      1200
     gtcgaagacc gcggccgcat tgcgctcgcc gaccccgagg tcttcaagcg cgatccggtc      1260
     aacatcatcc ggctcttcca cgtcgccgac atcaatgggc tggaattcca tccggacgcg      1320
     ctgaaacgcg ttacccgctc actcgccctg atcgacacca gcctgcggga aaacgacgag      1380
     gccaaccggc tgttcatgtc gatcctgacg tcgaagcgtg atccggcgct catcctgcgc      1440
     cggatgaacg aggccggcgt gctcggccgc ttcatccccg aattcggcaa gatcgtcgcg      1500
     atgatgcagt tcaacatgta tcatcactat acggtcgacg aacatctgat ccgcaccgtc      1560
     gacattctct ccgagatcga caaggggcgc gccgaggatc tgcatccgct cgccaacaag      1620
     ctgatgcccg gcatcgagga ccgcgaggcg ctctatgtcg ccgttctcct ccacgacatc      1680
     gccaagggcc gccaggagga tcattcgatt gccggcgccc gcgtcgcccg caagctctgc      1740
     gcccgcttcg gcctgtcgca gaagcagacg gaaatcgtcg tctggctgat cgaagaacat      1800
     ctgaccatgt cgatggtggc gcagacccgc gacctcaccg accgcaagac catcaccgat      1860
     ttcgccgacc gcgtgcagtc gctcgaccgg ctgaagatgc tgttgatcct gacgatctgc      1920
     gatatccgcg ccgtcggtcc cggtgtgtgg aacggctgga aaggccagct tctgcgcacg      1980
     ctctattatg aaaccgagct gctgctcgcc ggcggctttt cggaggtctc ccgcaaggaa      2040
     cgcgccaatg ctgctgccga ggcgctgcat tcggcactcg ccgactggag ccagaaggat      2100
     cgcaatacct ataccaagct gcactaccag ccctatttgc tctccgtgcc gctggaagac      2160
     cagatccgtc acgcccattt catccgccag tctgataaag cgggtcaggc gctcgccacc      2220
     acggtgcgca ccgacagttt ccacgcgatc accgagatca ccgtactgtc gcccgaccat      2280
     ccgcgactgc tcgccgtcat tgccggcgct tgtgctgcgg ccggggccaa catcgtcgat      2340
     gcgcagatct tcacgacatc ggacgggcgg gcgctcgaca cgatccatgt cagccgcgaa      2400
     tttaccgacg atgccgacga actgcgccgg gccgcgacga tcggccggat gatcgaagac      2460
     gtgctgtccg ggcgcaagcg gctgcccgag gtcatcgcca cacgcgcgcg caatcgcaag      2520
     aagagcaagg ctttcgtcat cccgccgtcg gtcaacatca ccaacagcct gtcgaacaag      2580
     ttcacggtca tcgaggtcga atgcctcgac cggccgggac tgctgtcgga gatcaccgcc      2640
     gtgctgtccg acctgtcgct cgacatccag tcggcccgca tcaccacctt cggcgagaaa      2700
     gtgatcgaca ccttctacgt caccgatctg gtcggccaga aaatatccgg cgacagcaag      2760
     cgcgccaaca tcaccgcccg gatgaaggcc gtcatggccg aggaagaaga cgagctgcgc      2820
     gagcgcatgc cctccggcat catcgcaccc gccgccaccg cccggacccc gcccgccgcc      2880
     gaaaagaagg ccggttcccc catatga                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page