(data stored in ACNUC7421 zone)

EMBL: CP001622.PE440

CP001622.PE440       Location/Qualifiers
FT   CDS_pept        459315..460085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0443"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   rce:RC1_3768 acylneuraminate cytidylyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54752"
FT                   /db_xref="GOA:C6B1N3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N3"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ACS54752.1"
FT                   /translation="MTTKPRSVAFIPARSGSKRVPNKNVRPLADHPMIAYSIRAAIDSG
FT                   VFDAVICATDSEIYADIARHYGAEVPFLRAAEISTDKSPDIEWVVWMLEQLRAEGREFD
FT                   IFSILRPTSPFRLPETIQRAWQQFTAEPRADSLRAIEKCKQHPGKMWVIRENRMLPLMP
FT                   FSIGTTPWHSSQYAALPEVYAQDASLEIAWSRVPLESNSIAGESIIPFVSQGYEGFDIN
FT                   EPDDWWMAERLLATQSAVLPNISINPYNLLNRPE"
     atgacgacga aaccgcgctc tgttgccttt attcccgcac gctctggttc aaagcgggta        60
     cccaacaaga atgtccggcc gctggccgac catcccatga tcgcctattc gatccgcgcc       120
     gccatcgaca gcggtgtttt tgacgcggtt atctgtgcaa cggacagcga gatttatgcg       180
     gacatcgccc gccactatgg cgccgaagtg ccgtttctgc gcgccgcgga gatctccacc       240
     gacaaatcgc cggatatcga atgggtggtt tggatgctgg aacaacttcg tgccgaaggg       300
     cgcgagttcg acatattcag cattctgcgc cccaccagcc cgtttcgtct tccagagacg       360
     atccagcgcg catggcagca gttcacggcc gaaccaagag cagattctct tcgcgcaatc       420
     gagaaatgca agcagcatcc cggcaagatg tgggtcatac gcgagaacag gatgctcccg       480
     ctaatgccat ttagcatcgg cacgacgcca tggcacagca gtcagtatgc ggctctgccc       540
     gaagtctatg cgcaggatgc cagccttgag attgcgtggt cgcgtgtccc gctcgaaagc       600
     aacagcatcg ccggcgaatc gatcatccct ttcgtcagcc aaggctatga aggcttcgat       660
     atcaacgaac cggacgactg gtggatggcc gagcgattgc tggcaacgca atcggcggtt       720
     ctcccaaata tctcaatcaa cccctataac ctattgaata gaccggagta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page