(data stored in ACNUC7421 zone)

EMBL: CP001622.PE441

CP001622.PE441       Location/Qualifiers
FT   CDS_pept        460089..461999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0444"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rce:RC1_3769 transketolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54753"
FT                   /db_xref="GOA:C6B1N4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N4"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACS54753.1"
FT                   /translation="MGDLVGQAVEGTLYYLPYKEFQRVRAINAPREQRAALFSDMCRLN
FT                   ALYMIGRAGSGHIGSSFSSLDIVSWLLLEGMTGDDVYFSSKGHDAPGYYAALIGAGKLD
FT                   FELTHKLRQIDGLPGHPDVGTPGMVTNTGSLGMGVSKAKGMVIANRLNNRPGRIFVMTG
FT                   DGELQEGQFWESLVSAANSGLQEITVIIDHNKLQSDTFVKNVSDLGDLEAKLRAFGWCV
FT                   ARCDGNDIAAFAATLAAIQDDPRPKVIVADTVKGKGVSFMEHTSLDSDVAMYRFHSGAP
FT                   DASNYRAAAQEIMDRLQANLSSAGITELEFETLERPASAAPSEKAQRLVAAYSKALIAQ
FT                   AKKHSNLVALDADLVLDTGLIPFREQFPDRFVECGIAEQDMVSTAGGMALNGLLPIVHS
FT                   FACFLSTRPNEQIYNNATEKTKIIYVGSLAGVVPGGPGHSHQSVRDISALAAMPGMTLV
FT                   EPSCDAEVGLLLDWCVNEAPGSSYIRLISLPWEIPYSLPADYRPTNGRGLTLAEGEDVA
FT                   IIAYGPVLLSNAIAASKVLAEKHGISAKVINLPWLNHVDAEWLQSTVSACKAIVCLDNH
FT                   YVIGGQGDTIARALAEAGTGIPVKHIGITGVPPSGTNVQVLGAVGLDASAIAETVASVI
FT                   G"
     gtgggcgatc tcgtaggaca agcggtagaa ggcacccttt attacctgcc atataaggaa        60
     ttccagcggg tacgtgcgat caacgcgcct cgcgagcaga gagcagctct attttctgac       120
     atgtgtcgcc tgaacgcgct ctacatgatc ggtcgggccg gctccggtca tatcggcagc       180
     agtttcagca gtctcgatat cgtcagctgg cttctcctcg aaggaatgac gggcgatgat       240
     gtctatttca gctccaaggg gcacgatgcg ccaggctatt acgcggcact gattggcgcc       300
     ggtaagctcg atttcgagct tacccacaaa cttcgccaga ttgatggtct gcccggccat       360
     cccgacgtcg gcaccccggg catggtgaca aatacgggct cgctcggcat gggcgtctcc       420
     aaggccaagg gcatggtgat tgcgaacagg ctgaacaacc gcccggggcg catcttcgtg       480
     atgacgggcg acggcgagct tcaggaaggc cagttctggg aatccctggt ctcggcagcc       540
     aattctgggc tgcaggagat tacggtcatc atcgatcaca acaagctgca gtcggacact       600
     ttcgtgaaga acgtgtctga ccttggtgac cttgaggcaa agctcagggc gtttggatgg       660
     tgtgtcgctc gctgtgatgg aaacgatatc gctgcttttg ccgccaccct ggccgccatc       720
     caagacgatc cgcgtccgaa ggttatcgtt gccgataccg tcaagggcaa gggcgtctcc       780
     ttcatggagc acacgtcact ggattccgat gtggccatgt accgcttcca cagcggcgcg       840
     cctgatgcga gtaattatcg cgccgccgcg caggaaatca tggatcgtct gcaagccaat       900
     ctgagcagcg ccggtatcac cgagctggag tttgaaacgc tcgagcggcc tgcatccgcg       960
     gccccgtcgg aaaaggctca gcgcctggtt gccgcctaca gcaaggctct gatcgcacag      1020
     gctaagaagc attcgaacct cgttgcactt gacgcagacc tggtgctgga taccggcctc      1080
     atcccattcc gcgagcagtt tcccgatcga tttgtcgagt gcggtatcgc agaacaggat      1140
     atggtttcta cagccggcgg catggcgctg aacggcctgc tgccgatcgt ccactcattc      1200
     gcgtgcttcc tgtcgacgcg gccaaatgag cagatctaca acaacgccac ggaaaagacg      1260
     aagattatat atgtcggctc ccttgcaggc gtcgttcccg gcggcccggg ccactcgcat      1320
     caatccgttc gagacatctc tgcgctggca gccatgcctg gaatgacgct ggtcgagccg      1380
     tcttgcgatg cggaagttgg tctgctcctg gattggtgcg tgaacgaagc tcctggcagc      1440
     agctacattc ggctgatttc actaccttgg gaaatcccgt attcacttcc ggccgactac      1500
     cggccaacaa acggccgagg actcactttg gctgaaggag aggatgtcgc cattatcgct      1560
     tacggaccgg tgctcctgag caatgcgatc gccgcctcaa aagtgctcgc tgagaagcac      1620
     ggtatcagtg ccaaggtcat caacctacct tggctaaatc acgtggatgc ggagtggctg      1680
     caatcgacgg tttcagcttg caaggcaatt gtttgcctcg acaaccacta tgtcatcggt      1740
     ggtcaaggcg atacgatcgc gcgtgcgctt gccgaagccg gaaccggaat tcccgtcaag      1800
     cacatcggga tcacaggggt tcctcctagc ggaaccaacg tccaagtcct cggcgcagtt      1860
     ggcctcgatg cctcggcgat cgccgagacg gtcgcgtcgg taatcggttg a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page