(data stored in ACNUC7421 zone)

EMBL: CP001622.PE442

CP001622.PE442       Location/Qualifiers
FT   CDS_pept        462121..463842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0445"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54754"
FT                   /db_xref="GOA:C6B1N5"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N5"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54754.1"
FT                   /translation="MSMHFIRRAIRFAKRVVSSKLSLQQSSAPAAAQQFSDWRRHLGTS
FT                   IDWKRALSSVSKGQEVLIATSVGGLSAATILEGMLGVALTLRGARVRFLLCDAVLPACL
FT                   HIHAGKIRDPAVITEYRLNKEICPGCIGRGRSHYGSLGLPVSYYSDFISEEERRALRKT
FT                   AREMPVSEIRGFRLKDMNLGEHAMAGTLRFFASGNLPATQEAEDVLRRYFEAALITETV
FT                   IQRYHEQFSPEVAVFHHGIYVPQGVIGEVCRAHGTRVANWQVGYRKKTFIFSHKETYHH
FT                   TLINESTDCWTDVPWSEATENEIMSYLKSRWYGSNDWIWFHDQPKHDAELIAKETGIDF
FT                   SKPTISLLTNVFWDAQLHFKANAFRDMLDWVLQSIEYFKGRPDLQLAIRIHPAEVRGAI
FT                   PSRQPLVDEIRKVYPTLPDNVYVIPPDSQVSTYVLCENSDTVVIYGTKTGVELTAMGIP
FT                   VVVAGEAWIRNKGLTMDATSPENYFDLLDRLPVGKRLDADTINRARKYAFHFFFRRFIP
FT                   IEFMEPSSNDAPYEIRINDLQDLLPGRDAGLDVLCNGILDGSEFVYPAEKYIGRTQ"
     atgagcatgc attttattcg cagggcgatc agatttgcca agagagttgt gagttcgaag        60
     ctgtcgctgc aacaaagttc tgcgcccgcg gcggctcagc agttttcgga ctggcgccgc       120
     catctcggca cgtccatcga ttggaaaagg gccttatcct ctgtttcgaa aggccaggag       180
     gttcttatcg cgacgagcgt cggcggtctg tcggccgcga cgatcctcga aggaatgctt       240
     ggcgtcgctc ttaccttgcg cggtgcgcgg gttcgctttc tcttatgtga cgcagttctt       300
     ccggcctgtc ttcacataca tgccggaaaa atcagggatc cggccgtcat cacagagtac       360
     aggctcaaca aggaaatctg tccaggttgc atcggaaggg gtagatcgca ttacggctct       420
     cttggactgc cggtctccta ctacagcgac ttcatttctg aagaagagag acgtgcattg       480
     cgcaagacag cccgcgagat gccggtttcg gaaattcgcg gctttcggct gaaagatatg       540
     aatctgggcg agcacgcgat ggcaggcacc ttgcgcttct tcgcttcggg aaacctcccg       600
     gcaacccagg aagccgaaga tgtattgcgg cgctattttg aggcggctct gatcacggag       660
     acggtcattc agagatacca tgagcagttt tcgccggaag tcgccgtgtt tcaccatggt       720
     atctacgtcc ctcagggggt aatcggggaa gtctgtcgtg cccatggcac ccgagtcgcc       780
     aactggcagg tcggctatcg caagaagacc ttcattttct cgcacaagga aacctaccac       840
     catactctga taaacgagtc taccgactgc tggacagacg ttccttggag cgaggccacg       900
     gaaaacgaga tcatgtccta tctcaagagc cgctggtacg gcagcaatga ctggatatgg       960
     tttcatgatc agccgaagca tgacgcagaa cttatcgcca aggagaccgg catcgacttt      1020
     tcgaagccca ccatcagtct cctgaccaat gtcttttggg atgcgcaact ccatttcaag      1080
     gccaatgcct tcagggacat gctcgactgg gtgctgcaga gtattgagta ttttaagggg      1140
     cgtcccgatc ttcaactggc tattcggatc catcctgccg aagtccgtgg cgccatcccc      1200
     tcacggcagc cgcttgtgga tgaaatccgc aaggtttatc cgaccctgcc ggacaatgtt      1260
     tacgtcatac cgccggacag ccaggtcagt acctatgttc tctgtgagaa cagtgacact      1320
     gtagttatct atgggacaaa aaccggcgtg gagctgaccg ccatgggaat tcccgtggtc      1380
     gttgcaggtg aggcgtggat acgtaataag ggcctcacca tggatgcgac ctcgccggag      1440
     aattattttg acttgctcga ccggctgccg gtcggcaagc ggttggacgc cgatacgatc      1500
     aatcgggcta gaaaatacgc attccatttc ttttttcgac gcttcatccc tatcgagttc      1560
     atggaaccat cgagcaatga cgctccctac gaaattagga tcaacgacct gcaggatctg      1620
     cttccgggca gggatgcggg ccttgatgtc ctatgcaacg gcattcttga tggaagcgag      1680
     ttcgtgtatc cggcggaaaa gtatatcggg agaacgcagt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page