(data stored in ACNUC7421 zone)

EMBL: CP001622.PE443

CP001622.PE443       Location/Qualifiers
FT   CDS_pept        463839..464504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0446"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: rsq:Rsph17025_4339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54755"
FT                   /db_xref="GOA:C6B2D5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D5"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACS54755.1"
FT                   /translation="MRPHWDHAFASGGVYQESDNWSKLLDPVFRVGERLYGQYSMRRIW
FT                   AAWKKAALLEPGVRLGGNARLINKHTRDAARIGENTVCRGIIRVERGARVDIGKEVYLG
FT                   DEAIISAMESVTIGRGTLIAHGVQIFDNTSHPIDWRGRERHFKRILGQPVDGSIEIPTA
FT                   PVSIGEHCWLGFGSAVLKGVTIGDRSIVAAGCVVTKDVPPDTLVVSSMATFIDLNKQG"
     gtgagaccgc attgggatca cgccttcgca agtggcggcg tctaccagga atcggacaat        60
     tggtccaaac tgctggatcc tgtcttccgc gtaggagaaa ggctctacgg ccaatattcc       120
     atgcggcgga tctgggctgc ctggaagaag gcggcgctgc tggaaccggg cgtcagactt       180
     ggcggaaatg ctagattgat caacaagcac accagggatg cagcccgtat tggcgagaac       240
     acagtgtgcc gagggatcat ccgggtcgag cgcggcgcac gtgtcgatat cggcaaagag       300
     gtctatctgg gcgatgaggc catcatcagc gccatggagt ccgtcaccat cggccgggga       360
     acgctgattg cgcatggcgt ccagattttc gacaatacct ctcatccgat cgattggaga       420
     ggtcgcgagc gccatttcaa aaggatcctg gggcaacctg ttgatggaag tatcgaaatc       480
     cctacagcgc ccgtgtctat tggggagcat tgctggctgg gattcggttc ggcagtgctg       540
     aaaggtgtga caatcggtga tcgttctatt gtcgccgctg gctgtgttgt gacaaaagac       600
     gtgccaccag acaccctggt tgtctcctcg atggcaactt ttatcgatct gaacaagcaa       660
     ggttag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page