(data stored in ACNUC7421 zone)

EMBL: CP001622.PE444

CP001622.PE444       Location/Qualifiers
FT   CDS_pept        464519..465313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0447"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: dde:Dde_0428 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54756"
FT                   /db_xref="GOA:C6B2D6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D6"
FT                   /inference="similar to AA sequence:KEGG:Dde_0428"
FT                   /protein_id="ACS54756.1"
FT                   /translation="MLATQQMPQYSVMDQFVESICYRAPENRTQWYPPLMRSAESLGKR
FT                   AISADAAEDALAVLRKLEPDDYSEYLSAYYAEGIRRFGANWRYADIVTVLLALAVDLKP
FT                   KSYLEIGVRRGRSVCTVASKAPTCDIYMFDMWVANYAGMENPGESLVSSELDKVSHTGK
FT                   RVFTNGNSHSTLKTFFRQNSDLAFDMITVDGDHTRNGAIEDLCDVLPRLKIGGAVVFDD
FT                   ICHPKHRYLEDVWKELVVNDNRFTSWSCADIGYGVGFALRKW"
     atgctagcaa ctcaacagat gcctcaatat tcggttatgg atcaattcgt ggagtcgatc        60
     tgctacaggg cgccggaaaa ccggacacag tggtaccctc ccttaatgag atccgcggaa       120
     tccctgggga agcgtgcgat cagtgccgac gcagcggagg atgcactcgc agtgctgcgg       180
     aaactggagc ctgatgacta ctccgaatat ctctcggcct attatgcaga aggcatcagg       240
     cgctttggcg cgaattggcg ctatgcagac atcgtcacgg tcttgctggc tctggcagtc       300
     gacttgaagc cgaagagtta tctggagatc ggcgtgcgcc gcgggcgcag cgtctgcact       360
     gttgcgtcga aggcacccac ttgcgacatc tatatgttcg acatgtgggt tgcgaattat       420
     gcgggcatgg aaaacccggg cgaatcgctt gtctccagcg aactggacaa ggtttcgcac       480
     acgggaaaac gcgttttcac caacggcaac tcccactcca cgctaaagac cttcttccgc       540
     caaaatagcg atctcgcctt cgacatgatc accgtcgacg gcgaccatac acgcaacggc       600
     gcaatcgagg acctgtgcga cgtgctgccc cgtctcaaga tcggcggcgc ggtcgtattc       660
     gacgatatct gccatccgaa gcatcgctat ctggaagatg tctggaaaga gctggtcgtc       720
     aacgacaacc ggttcacctc gtggagctgt gccgatattg gttacggcgt tggattcgcc       780
     ttgcggaaat ggtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page