(data stored in ACNUC7421 zone)

EMBL: CP001622.PE445

CP001622.PE445       Location/Qualifiers
FT   CDS_pept        465307..466230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0448"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: dvm:DvMF_1854
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54757"
FT                   /db_xref="GOA:C6B2D7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54757.1"
FT                   /translation="MVNTSERLLVLGASGFLGTVISTYFSSLGIPVMGIDVVPPQDKHI
FT                   YSDFYQSERMEEILETALARHQPTYLVHVAGNANVGRSIEDPRYDFVNSVDLFSLVLDQ
FT                   VRRVSLGTKVLFTSSAAVYGQPKVLPITEELAPSPISPYGYHKWMCEQLSREYSSLYEV
FT                   SVASIRIFSAYGAGLRKQILWDLCEKCRSDGPVQLGGDGSETRDFIHAKDIARAISCVV
FT                   RGGTFNGEVYNVASGVETSISDLAHHVLSAYGIPFDRLGFSGSSRVGDPKNWRADVSRL
FT                   EALGFSPTIDFVAGVAEYVDWYKKLR"
     atggtgaaca cttcagaacg gctgctggtt ctcggggcgt ccggttttct gggcacagtc        60
     atttcgacct atttctcgtc gctcggtatt ccggtgatgg gtatcgacgt tgttccgcca       120
     caggacaagc acatctacag tgatttttat cagtccgaac ggatggaaga gattctggag       180
     actgcgcttg ccaggcatca accgacgtac cttgtccacg tcgcgggcaa cgccaacgtc       240
     ggtcgttcga ttgaagaccc tcgctacgac ttcgttaatt ccgtcgatct tttctccctc       300
     gtgctagatc aggtcaggcg ggtgtcgctc ggaacaaagg ttctcttcac gtcaagtgct       360
     gcggtatacg gacagccgaa ggttttgccc ataacggagg agcttgcgcc gtcccccata       420
     tcaccgtatg gctatcacaa gtggatgtgc gagcaacttt ctcgcgagta tagctcgctt       480
     tacgaagttt cagttgcgtc cattcggata ttttccgcct atggcgccgg ccttcgaaag       540
     cagatcctgt gggatttgtg tgagaagtgc cgcagcgatg gcccagttca actcggcggc       600
     gacgggagtg agacgagaga tttcattcac gcgaaagaca tcgcgcgagc catatcatgc       660
     gtcgtccgcg gaggcacctt caacggtgaa gtctacaacg tcgccagcgg cgtggagaca       720
     tccatatcgg atctcgcgca tcatgttctc tcagcctacg gcattccatt cgaccgttta       780
     ggattcagcg gctcaagccg cgttggtgat cccaagaact ggcgcgccga tgtcagtagg       840
     cttgaggcgc tcggtttctc gccaacgatc gatttcgttg cgggggttgc cgagtacgtg       900
     gattggtaca agaaactgcg atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page