(data stored in ACNUC7421 zone)

EMBL: CP001622.PE446

CP001622.PE446       Location/Qualifiers
FT   CDS_pept        466227..467411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0449"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ret:RHE_CH00756 alpha-glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54758"
FT                   /db_xref="GOA:C6B2D8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54758.1"
FT                   /translation="MKILIYLTGGTHWIGGVQYTRNLLRAVSLLPAQERPALVLQIGRK
FT                   NAGQGYEEEFSHYPGVVIDGPLERGSAIRSRILDLARRAWKRSTGKDLRQKLLHSDECD
FT                   VAFPAKGPNIPGLAQKVYWVPDFQYKHFPQFFSEDERRSRDAFYGKMFDESGILVLSSE
FT                   AVKADFIRFFPTYSQKPVRILHFSSTLHDEEYALDPVAVCAKHGLPEKFVYLPNQMWQH
FT                   KGFDAAFRALGILKRAGVIIPLVLTGSSEDYRSNDYARQLEEILTEYDLQDQIYRLGVL
FT                   PRSEQLQLFRRAAVVLQPSRFEGWSTTVEDTRALGRPIVLSNIDVHLEQAPPNASYFVV
FT                   GDQKDLADKLGKAWLTAEAGPDFKQEDAARKAANLNSLAYARTFLSIMRQAHRE"
     atgaagatat tgatctatct caccggcggt acccactgga ttggcggtgt ccagtacact        60
     cgcaacctgt tgcgcgctgt ttcgctgctg ccagcgcagg aacgccccgc gctcgtgctt       120
     cagataggtc ggaagaatgc tggccaagga tacgaggagg aattctcgca ctatcccggg       180
     gtggtcatcg atgggccact tgagcggggt tcggcgatcc ggtcaagaat attggatctc       240
     gcgcggcgcg catggaagag gtcgaccggc aaggatctac gtcagaagct tctgcactcc       300
     gacgagtgtg acgtcgcatt tcctgcaaaa ggtccaaaca ttccgggttt ggcacagaag       360
     gtctattggg ttcctgattt tcagtacaag catttcccac agtttttctc cgaagacgag       420
     cgacgtagcc gtgacgcctt ttacggaaag atgtttgatg agagcggcat tcttgtcctg       480
     agcagtgaag cggtgaaagc cgacttcata cggtttttcc cgacctattc ccaaaaaccg       540
     gtgcgcatcc tccacttttc aagcacgctt catgacgagg agtatgccct ggatccagtc       600
     gcggtctgtg ctaaacatgg cttgccggaa aaatttgtgt atctgcccaa tcagatgtgg       660
     caacacaagg gcttcgacgc cgcctttcgt gcgctgggca ttctgaaacg cgcgggggtt       720
     atcatccccc ttgtcctgac ggggagctca gaggattatc gcagtaatga ctacgctcgc       780
     caactcgaag aaatcctgac ggaatatgac cttcaggatc agatctaccg tctgggcgtc       840
     ctgccgcgaa gcgagcaact tcagcttttc cgccgcgctg ccgttgttct tcagccatca       900
     cggttcgaag ggtggagcac gacagtcgaa gatacccgcg ccctggggag gccgatcgtg       960
     ttgtcgaaca tcgatgttca tctggagcag gcccccccaa acgcgagcta ttttgttgtc      1020
     ggggatcaaa aagatcttgc ggataagctc ggcaaagctt ggctcaccgc cgaggcgggg      1080
     cctgatttca aacaggaaga tgccgcacgc aaggcggcaa acctcaacag tttggcgtat      1140
     gcgaggacct ttctttcaat tatgagacag gctcatcgcg agtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page