(data stored in ACNUC7421 zone)

EMBL: CP001622.PE447

CP001622.PE447       Location/Qualifiers
FT   CDS_pept        467449..468279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0450"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sfu:Sfum_3355
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54759"
FT                   /db_xref="GOA:C6B2D9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACS54759.1"
FT                   /translation="MKNQEKITYIKPAGRFAKIDLEEHWRARYMFTMLVWKKIRASFGE
FT                   MYFWFIWVCAKPLLYVMIFSLFKHWSQARTGVEIPYVLYIYSGLILWYYFLETAIDVSL
FT                   NIKANAALVTKIYLPRMITPTVPLLANLMDLAISMIPLILMMIYYGVYPGWQILMIIPT
FT                   LLVVMITAMGTGLIIATITLRLRDFQKIFEFSLYLAMFISPVIFSPSMIPEAFHWVYHM
FT                   NPMVGALIGWREALFGSASFPWGAWVYSCSFAVLALIVGLYLYLRFEHEMIEAI"
     atgaaaaatc aagagaaaat aacgtatatc aaacccgcag ggcgcttcgc caaaatagat        60
     ttagaggagc attggcgcgc gcgctacatg ttcacaatgc tggtctggaa gaaaattcgc       120
     gcctctttcg gggagatgta cttctggttc atctgggttt gcgccaagcc tctgttgtac       180
     gtgatgatat tttcgctctt caagcactgg tcgcaggctc ggaccggggt ggaaatacca       240
     tatgttcttt atatttatag cgggcttatc ctttggtact acttcctcga aaccgccatc       300
     gacgtatcgt tgaatatcaa ggccaatgcg gctctcgtga cgaaaatata ccttcctcgg       360
     atgatcacgc ccacggtgcc gttgctggcc aatctgatgg acctggcaat atccatgata       420
     ccgctgatcc tgatgatgat ctattatggg gtctatcccg gatggcagat cttgatgatc       480
     attccaacgc tcttggttgt gatgatcaca gccatgggga ccggccttat tatagcgacg       540
     atcactctgc ggctgcgcga ctttcagaaa atatttgagt tttcgctcta cctcgcgatg       600
     tttatctcgc cggtcatctt ctcgcccagc atgattcccg aagccttcca ttgggtctac       660
     catatgaatc cgatggtcgg tgcattgatc ggttggcgag aagcgctctt cggatcggcc       720
     tcattcccat ggggagcttg ggtttattcc tgctcctttg cagtgctggc tctcattgtc       780
     ggcctctatc tctatctcag gttcgaacat gaaatgatcg aggcgatcta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page