(data stored in ACNUC7421 zone)

EMBL: CP001622.PE448

CP001622.PE448       Location/Qualifiers
FT   CDS_pept        468284..469552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpe:RPE_4248 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54760"
FT                   /db_xref="GOA:C6B2E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54760.1"
FT                   /translation="MAESVIEVFDISKQYEIGSGGGLSMSKLARETALWPYRKMRGQSV
FT                   PPLYRKRQNFWPLRDVSFSVDRGEVVGIIGANGAGKSTLLKILSRIVTPTSGSATIRGR
FT                   VSSLIEVGTGFNANLSGRENVFLNASLHGLSREEVAARFDEIVDFSGVGKFIDTPVKHY
FT                   SSGMYSRLAFSVAAHLDPDLLFVDEVLAVGDMAFQQKCLNRFSEMVGGNRTVLFVSHNL
FT                   SAVSNICSKVLWLDQGRVRYFGPTEEGIAAYYEATMPSTAQTLETRFDRTGTGDFMFNK
FT                   ISFYDSSMQPSERVTTGQELIIGLEYRAKLEMIGDIRDMSLVVIFKNDKGHRLFGLPSD
FT                   VLAHGETPRLTETGEYLVKIPSLPLLPGIYDLDLGCIINRATTDKIVSAKRLIVTESDF
FT                   FGSGKLPPVQQGDLLVRFDNEWR"
     atggcagagt cggtcatcga agttttcgat atttccaagc agtatgaaat tggttcaggc        60
     ggaggcctga gtatgagcaa acttgctcgt gagacagcat tgtggccgta tcgcaagatg       120
     cgtggccagt ctgttccgcc cctctacagg aaaaggcaga atttctggcc gctgcgtgac       180
     gtctcgtttt ctgtggatcg cggcgaagtt gtcggaatta tcggcgcgaa tggcgccggt       240
     aaaagcacac ttctgaagat attatcccgc attgtcactc caacatcggg aagtgcgacc       300
     attcgagggc gcgtcagctc gctgattgaa gtgggcaccg gcttcaacgc caatctttcc       360
     ggacgtgaaa acgtcttctt gaatgcgtcg ttgcatgggc tgtcacgtga agaagtcgcc       420
     gcacgtttcg acgagatcgt cgacttttcc ggggtcggca aattcatcga caccccggtc       480
     aagcactact cgagtggcat gtacagccgg ctggccttct ccgttgcagc gcacctcgac       540
     ccagatcttc tgttcgtgga tgaagtgctc gccgtgggcg acatggcgtt ccagcagaaa       600
     tgcctcaacc gcttttccga gatggtgggc ggcaaccgaa ccgtgctgtt cgtcagccac       660
     aaccttagcg ccgtctcgaa catctgttca aaggtactat ggctggatca ggggcgcgtc       720
     cggtattttg gtccgaccga agagggtatc gcggcctatt atgaagcgac tatgccttca       780
     acggcgcaga cgctcgaaac ccgcttcgac cggacaggca ccggcgattt catgttcaat       840
     aagatctcct tctatgactc ttcgatgcag ccctccgaac gggtgacgac cggacaagaa       900
     ctcatcatcg ggctggagta tcgcgctaaa ctggaaatga tcggggatat ccgcgatatg       960
     agtttggtgg tcattttcaa gaatgataaa ggtcaccggc tgtttggctt gccaagcgac      1020
     gtgcttgcgc atggtgagac gccgcgcttg acagaaacag gagaatatct cgtcaagatc      1080
     ccaagccttc cgctgcttcc gggcatctac gacttggatc tgggatgcat aatcaaccgt      1140
     gcgacaacag acaagatcgt atccgccaag cgcttgattg tcaccgaatc ggattttttt      1200
     ggctccggaa agcttccgcc ggttcagcaa ggtgatctcc tggtgcgttt cgacaatgaa      1260
     tggcgctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page