(data stored in ACNUC7421 zone)

EMBL: CP001622.PE449

CP001622.PE449       Location/Qualifiers
FT   CDS_pept        469568..470608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0452"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   rpe:RPE_4247 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54761"
FT                   /db_xref="GOA:C6B2E1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E1"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACS54761.1"
FT                   /translation="MNKIFDRTKLWLLDYLLRDDWNDGNNKVAKFDAQKALKGLENMKA
FT                   GRILLKQFVEVLFSSGAMIGRIERILQSMRIPTYLLMHSVLAKCLLLLDVHPKARLAEL
FT                   HAAGMLEEEFGIALNTHLAAVAFEKTRQISKIRELYAEEIFDGISRISLPLSISNEASH
FT                   HENHMDMMFVVAAAKHRGAKRIFEFGTYMGRTTVGLASIDADATVTTLNLDPAEDTRYG
FT                   PYIGKLIKDSPYRDRITQIFSDSKKFDTTPYAKSMDYIFIDADHSYDAVKNDTEKSLEM
FT                   LAPGGVIIWHDYAPKSPGVFGYLQELSLQRSLFRIRNTCLVLYIDGVDADEFEPKSDAG
FT                   FLEDVS"
     gtgaacaaga tttttgatag aacgaagctt tggctgcttg attatctcct tcgagatgat        60
     tggaacgacg gcaacaacaa ggtcgcgaaa ttcgatgccc aaaaggcctt gaagggcctt       120
     gagaacatga aagccgggcg aatcctgctg aagcagttcg tagaagtgct cttctcctcg       180
     ggtgccatga taggacggat cgaacgtatc ctccagtcga tgcggatacc gacatatttg       240
     ctgatgcact ccgttctggc caagtgcctt ctgctccttg atgttcatcc taaggcgcga       300
     ctggcggaac ttcatgccgc tggaatgctg gaagaggaat tcggcatcgc actcaacact       360
     catctggcag ctgtggcttt cgagaaaacc cgccagatca gcaagataag ggaactgtat       420
     gcagaagaga tcttcgacgg catcagtcgt atctcgctgc cgttgagcat cagcaacgag       480
     gccagtcatc acgaaaacca catggacatg atgttcgtgg tggcggcagc gaagcatcgc       540
     ggtgcaaaac ggatcttcga attcggaact tatatggggc gcacgaccgt agggcttgcg       600
     tcaatagatg cggatgccac tgtcaccaca ttgaacctcg atccggctga ggacacgcga       660
     tacgggccgt acatagggaa actgatcaag gacagcccct atcgcgaccg aattacgcaa       720
     atattttcgg actccaaaaa attcgacacg acaccctatg ccaaaagcat ggattacatc       780
     ttcatcgacg cggatcacag ctacgacgcc gtcaagaacg acacggagaa gtctctggag       840
     atgctcgctc ccggtggtgt cattatatgg catgattatg ctccgaaaag ccccggtgta       900
     ttcgggtacc tgcaggagct cagcctccag cgttcgctgt tcaggatcag gaatacctgt       960
     ctagtgcttt atattgatgg tgtggatgcc gacgagttcg agcccaaaag cgatgctgga      1020
     tttctggaag acgtatcttg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page