(data stored in ACNUC7421 zone)

EMBL: CP001622.PE45

CP001622.PE45        Location/Qualifiers
FT   CDS_pept        complement(43368..43643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54357"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000428"
FT                   /protein_id="ACS54357.1"
FT                   /translation="MFMEKLVRETERLSLICSMLDTMRRADKDRNARGWTSPIGMLKIT
FT                   RCCAVISELGTSIAKAGYRECDRQALEEIMRETRQVLHLLNARAAG"
     atgttcatgg aaaaactggt tcgcgaaacc gagcgcctct cgctcatctg ctccatgctc        60
     gatacgatgc ggcgcgccga taaggaccgc aacgcccgcg gctggacgtc gccgatcggc       120
     atgctgaaaa tcacccgctg ctgcgctgtg atctcggagc tcggcacctc gattgccaag       180
     gccggctatc gcgaatgcga caggcaggcg ctcgaggaga tcatgcgcga gacacggcag       240
     gtgctgcatt tgctgaatgc gcgggccgcc ggctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page