(data stored in ACNUC7421 zone)

EMBL: CP001622.PE450

CP001622.PE450       Location/Qualifiers
FT   CDS_pept        470623..471375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0453"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   rpe:RPE_3384 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54762"
FT                   /db_xref="GOA:C6B2E2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E2"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ACS54762.1"
FT                   /translation="MTANSHEYPVAVDDQQFLVRCINDVERGRAASFLSKEPETVRWLK
FT                   AEMVPATVFWDVGANVGLFSLYAAILQPTAQILAFEPAAHNYASLCDNIVINGFTNIVP
FT                   FSVALGQGNLAFDELHLSKVEAGSSIHHVGAKSPWAESEPVFRQPCVKVSIDSMVLDHD
FT                   FPPPTLLKIDVDGLELGILDGARTVLNQVKSVLVELDANDPSEISAATNLLEQAGFRLT
FT                   ETSRREKTINRKLPRNHIWMNAALRPLD"
     gtgacagcaa attcgcacga gtatccagtt gcggtcgatg accagcaatt cctagttcga        60
     tgcatcaacg acgtagaacg ggggcgagcg gcctccttcc tgagtaagga acctgaaacg       120
     gttcggtggc tcaaggcgga aatggtgcca gctaccgttt tctgggatgt cggcgccaat       180
     gtggggctct tttcacttta tgccgcgatt cttcagccga ctgctcaaat acttgcgttc       240
     gagccagcgg cccataacta tgcgagcctc tgcgataaca tcgtgattaa cgggttcacc       300
     aacattgttc ccttcagtgt ggctctcggc caaggtaatt tggcttttga tgagcttcat       360
     ctatcgaagg tagaagcggg aagctcgatc catcatgttg gggcgaagag tccgtgggca       420
     gagagcgagc cagtcttccg gcaaccttgc gttaaagtct ccatcgactc catggtgctt       480
     gatcatgatt ttccgccacc gacgttactg aaaatcgacg tcgacgggct tgaactgggc       540
     atcctcgacg gtgctcgtac cgtgttaaac caagtaaaaa gcgtgcttgt cgagcttgac       600
     gcgaatgacc cgtcggaaat ctcagcagcg acaaatctgc tggaacaagc cggcttccgg       660
     cttactgaaa cgagcagacg tgaaaagacc atcaatcgaa aacttcccag aaatcatatt       720
     tggatgaacg ctgcactgcg tccattagat tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page