(data stored in ACNUC7421 zone)

EMBL: CP001622.PE451

CP001622.PE451       Location/Qualifiers
FT   CDS_pept        471455..472354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0454"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54763"
FT                   /db_xref="GOA:C6B2E3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS54763.1"
FT                   /translation="MEHQLSIVLGTYNRLDQLQRCVESIVSQTKTVFRLYVTDAGSTDG
FT                   TVEYLQSIAGENIIPVLVGKKLGQAKAYNDVFNIVTTPYVCWLSDDNEVIDHGLDRAVS
FT                   IIRTDPSIGMVALKTKDLQGPFVDAPFIGGVSSTGILNVNQGLLPTALLKKIGGFSEEF
FT                   RDYGIDNALTAEVLFAGYKVVYSRKVALQHYRNWSEDPTSENYQWLKQRHEAAKVLYEE
FT                   RYGNQNTQELSGSYRMKTKVARRVKAGAKRYLTSDYVRTSAAVRTCFIILSSRYISILD
FT                   PILTFGRDYHLVQKRRTG"
     atggagcatc agctatcgat tgttttaggc acatataacc ggctggatca actccagagg        60
     tgtgtcgaaa gcatcgtcag ccagaccaag acagtctttc gtctttacgt aaccgacgcg       120
     ggttcgacgg atggcacagt ggagtacctc caaagcattg ctggagaaaa cataataccc       180
     gtgctggtcg gcaagaagct gggccaggcc aaggcgtata acgatgtttt taacattgtg       240
     acgacgccct atgtatgctg gctgagcgac gataacgaag tcatcgatca tggcctggac       300
     cgtgctgtct ctatcattcg aacggatccg tcgatcggca tggtggctct taagaccaaa       360
     gatcttcagg ggcctttcgt cgacgcgccc tttattggcg gcgtttcttc gacgggcata       420
     ttgaatgtca accaagggct gctgcccacc gctctgttga agaaaatagg gggattttct       480
     gaagagtttc gcgattacgg catcgacaac gcgttgacag cagaggtcct gtttgcgggg       540
     tacaaggtgg tatacagccg caaggttgcg ctacagcact ataggaactg gagcgaggat       600
     ccgacctccg aaaactatca gtggctcaag cagcgccacg aagccgcaaa ggtgctgtat       660
     gaggaacggt acggcaatca gaatacccag gagttgtctg gctcgtaccg gatgaagaca       720
     aaggtcgccc gcagggtcaa ggcgggggca aagcgctatc tgacaagcga ttatgtccga       780
     accagcgcag cagtgcggac atgttttatt attctctcat ctcggtacat cagcattctg       840
     gacccaatcc tcaccttcgg tagggactat catctcgtcc aaaaaagaag gaccgggtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page