(data stored in ACNUC7421 zone)

EMBL: CP001622.PE452

CP001622.PE452       Location/Qualifiers
FT   CDS_pept        472699..474471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0455"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54764"
FT                   /db_xref="GOA:C6B2E4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E4"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54764.1"
FT                   /translation="MKYRHPIAALTVPTRPLLSRIRDRLSRHGWYRRFHLAYVRWRARH
FT                   GGLPDWAAWQPQAGLEPVRPPLIDGAKRVLVATGTAGHLPSMTMESLLGMALAIRDASI
FT                   DFLICDAALPACMMCEISWYSDVDKLAKHGPKDRCLTCYRPSAEMLDRAGLNAIGLNSK
FT                   LTDADRFKAKTTSTQMPQSEIAAYIEDGIPIGEHAVAGALRFFSRGDLEKVSGADVILR
FT                   RYLEAAILTYYGTRRLLAEGHYDAVVLNHGIYVPQGIISETARHLGVRVVTWHPAYRRG
FT                   CFIFNHHETYHHGLMTEPVSSWEDMSWNGMQQQQITQYLRSRWVGQQDWVKFHDQPEFD
FT                   TRSIEEEIGIDFRRPTIGLLTNVIWDAQLHYKANAFPNMVDWLIKTIAYFEKRPDLQLL
FT                   IRVHPAELTGTLPSRQPAVDEIRRQFPNLPANVFIIPPESKASTYVAMSHCNAVLIYGT
FT                   KMGVELSAMGIPVIVAGEAWIRGKGVTMDATSEENYLRLLDALPLRERLNDATIERAQK
FT                   YAYHFFFRRMVPLDCIKERKGWPPFAVHIDSLDDLAPGKSPGLDIVCNGIIAGTPFIYP
FT                   AEDLMGAPSDRRAT"
     gtgaaatatc gccaccccat tgctgcctta accgtgccta cgaggccgct gttgtctcgc        60
     attcgcgaca ggcttagccg acatggttgg tatcgccgct ttcatctcgc atatgtaaga       120
     tggcgtgccc gccatggtgg actgcccgac tgggcggcat ggcaaccaca agcgggactc       180
     gagccggtac gcccaccttt gatcgacggc gccaagcgcg tcttggttgc aacaggcact       240
     gccggacatc tgccgtccat gacgatggaa agcctgcttg gaatggcatt ggcgattcgt       300
     gacgccagta ttgacttcct catttgcgat gcggcgctgc ctgcctgcat gatgtgcgag       360
     atcagttggt attctgatgt cgacaagctg gctaagcatg gcccaaaaga ccgctgtctg       420
     acctgctatc gaccatccgc tgaaatgctc gaccgggccg gactcaacgc gatcggactc       480
     aactcgaaac tcactgacgc cgatcgcttc aaggcaaaga cgacttcaac gcagatgccg       540
     caaagcgaga tcgcggcgta tatagaggac ggcattccca tcggggagca cgccgtggcg       600
     ggcgctctcc gttttttttc aagaggcgac cttgagaagg tgtctggagc cgacgtgatc       660
     cttaggcgtt acctggaagc ggcgattctg acctattacg gcacccgacg cctgcttgcc       720
     gaaggtcact atgatgccgt ggtgttaaat cacgggatat atgttcccca gggcatcata       780
     tcggaaacag cccgacacct cggcgtgcgc gtggtgacgt ggcatccagc ctacagacgg       840
     ggatgcttta tcttcaatca ccatgaaacc tatcatcatg gcttgatgac cgaaccggta       900
     tcgtcttggg aggatatgtc ttggaacggt atgcagcagc agcagatcac gcagtatctc       960
     cgtagcagat gggttggcca gcaagactgg gtgaagtttc acgatcagcc ggagttcgat      1020
     acccgctcga ttgaggagga aatcggcatt gatttccgac gtccgaccat cgggttgctc      1080
     acaaacgtga tttgggacgc gcagctgcat tacaaggcaa acgcctttcc gaacatggtt      1140
     gactggttga tcaagaccat tgcctacttc gaaaagcggc ccgacctgca gttgctgata      1200
     cgggttcatc cggccgaact tacagggacg cttccatccc ggcagcctgc cgtcgacgaa      1260
     attcggcgcc agtttcctaa cctgccggca aatgtcttca tcattccgcc cgaaagcaaa      1320
     gcaagtacct acgtcgccat gtctcactgc aacgccgtcc tgatctatgg cacgaaaatg      1380
     ggcgttgagc tttcggcgat gggaataccg gtcattgtcg ccggtgaggc ctggattcgt      1440
     ggcaaaggcg ttacgatgga tgcaacctcg gaagaaaatt atctgcgctt gctcgatgct      1500
     ctgccgctgc gggaaaggct gaatgacgcc acgatcgaac gggcgcagaa atatgcttat      1560
     cacttcttct ttcggcgcat ggtcccgctg gattgtatta aggagcgaaa gggctggccg      1620
     ccattcgccg tgcatataga tagtctggac gaccttgcac ccggcaagtc gcccgggctc      1680
     gacatcgttt gcaacggcat catcgcgggg acacccttca tctatcccgc agaggacctc      1740
     atgggagcgc cctcagaccg gagagcgacg tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page