(data stored in ACNUC7421 zone)

EMBL: CP001622.PE453

CP001622.PE453       Location/Qualifiers
FT   CDS_pept        474468..475568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0456"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bov:BOV_0533 putative mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54765"
FT                   /db_xref="GOA:C6B2E5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54765.1"
FT                   /translation="MRISIDATGLGGPKTGTSVYLIEILSRWSRNTSINHEFTIFASEK
FT                   AVSLCSEAGLDHRFRFVRAPNNRHIRVIWQQLMIPWHMRRLGIDVHWGTAFVLPVASQR
FT                   PMAVTIHDLTFQLFPEVHERLKRFYFPAIMQRSVAKAQAVFAVSRTTETDLKRIIPESR
FT                   GKTTVTLLAARKLGSDSQAPRDQRNSGDYLLFVGTLEPRKNLPRLLAAWQMLDDATRGN
FT                   TRLVIVGATGWMVSDLLQSLKTNDTIDFLGHVSDSSLAELMQGARALLYPSLYEGFGLP
FT                   VVEAMARGIPLLTSNTGATAEIAEGAAILVDPTNVDDIRGGLVRLLTEPELLGALSAQG
FT                   RERAKSFSWERTAQLTLETLEGLKRA"
     gtgagaatta gtattgacgc aaccggattg ggcggcccca agacaggaac atcagtctat        60
     cttatagaga ttttgtcgcg ctggagccgc aatacgtcca tcaaccacga gttcacgatc       120
     ttcgcgagcg agaaggccgt ttccctctgc tcggaagccg gattggacca tcggtttcgt       180
     ttcgtccgcg cgcccaacaa ccgccatatc agagtgatct ggcagcagct aatgattccg       240
     tggcatatgc gccgacttgg aatcgatgtg cattggggga cggccttcgt attaccggtg       300
     gcttcgcaaa ggccaatggc cgttacaata catgacctaa ccttccaact gtttcccgag       360
     gtgcacgagc gcttaaagcg cttttacttt ccggctatta tgcaacgttc agtggcaaag       420
     gcgcaggctg tatttgcggt gtctcggacc acagaaacgg acctaaaacg catcattcca       480
     gagagtagag gaaagacaac cgtcacgctg ctggctgcac gcaagctggg ctcggattcg       540
     caggctcccc gcgaccaacg taactcaggc gactacctgc tcttcgtcgg aaccttagag       600
     ccacgaaaga atcttccacg attgctggcc gcctggcaga tgctcgatga tgccacccgg       660
     ggcaacacgc ggcttgttat cgtcggcgcc acgggatgga tggtaagcga cttgctacaa       720
     agcctcaaga cgaacgatac catagatttt ctggggcacg tcagcgattc ttctctagca       780
     gaactgatgc aaggcgctag ggcccttctc tatccatcac tctacgaggg gtttggtttg       840
     ccggtggttg aagcgatggc gcgcggaata ccgctgttga ccagcaatac cggcgctacc       900
     gcggagatcg ccgaaggcgc ggcgatcctt gtcgacccga cgaatgtgga tgacatccgt       960
     ggcggacttg tgaggctgct gacggaacca gagctgcttg gcgccctgtc cgcccaaggc      1020
     cgcgagcggg caaaatcatt ctcctgggaa cgcacggccc aactgacatt ggaaaccctg      1080
     gaagggttga agcgagcatg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page