(data stored in ACNUC7421 zone)

EMBL: CP001622.PE454

CP001622.PE454       Location/Qualifiers
FT   CDS_pept        475565..476308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0457"
FT                   /product="glycosyl transferase family protein"
FT                   /note="KEGG: neu:NE0499 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54766"
FT                   /db_xref="GOA:C6B2E6"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E6"
FT                   /inference="similar to AA sequence:KEGG:NE0499"
FT                   /protein_id="ACS54766.1"
FT                   /translation="MSDICVSIVSHGQGEIANLLLDDLDSRCSGLNVVLTKNIPEELPI
FT                   RDRRYPFLQIENPSPKGFAANHNQAFRRCDSGLFCVANPDIRLQADPFGHLKAAMSDPR
FT                   VGLVAPLIVNPGGTIEDSARYFPTPFGLLRKALGKSDGRFPIDPNRSSAVDWTAGMFML
FT                   FRSEAFAEVGGFDEGFFLYYEDVDICARLWKAGWKVILLPTVSVVHDARRASHADAKYM
FT                   RWHVSSMMRYFTKHLGRTPDISRMT"
     atgagcgata tatgcgtgtc catcgtgagc cacggacagg gggagattgc gaacctgctg        60
     ctggacgatt tagacagtcg ctgttccggg ctcaatgttg tcctgaccaa aaacattccg       120
     gaagaattgc ctattcgaga cagacggtat ccgttcctac aaatcgagaa cccttctccc       180
     aagggcttcg cagcaaacca taaccaggca tttaggcgct gcgacagtgg tttgttctgc       240
     gtcgcaaatc ctgacatccg gcttcaggcg gatccgtttg gccatctcaa agcggcgatg       300
     agtgacccca gggtcggcct tgtggcccct ctgatagtca atcccggggg aaccatcgaa       360
     gacagcgctc gatactttcc gacgcctttc ggtcttctca ggaaggcgtt gggcaagagt       420
     gacggaagat ttccgataga tcccaaccga tcttcagcgg ttgattggac tgcaggcatg       480
     ttcatgcttt ttcggtccga agcattcgcg gaagtcggcg ggtttgatga aggttttttc       540
     ctctactacg aggatgtgga catctgtgct aggctatgga aggcaggctg gaaggtcatt       600
     ctgctgccaa cagtctccgt ggttcacgac gctcgccgcg cgagtcacgc cgatgcgaaa       660
     tacatgcgat ggcatgtctc gagcatgatg cgatacttca caaagcatct cggccgcacg       720
     cccgacataa gcaggatgac ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page