(data stored in ACNUC7421 zone)

EMBL: CP001622.PE455

CP001622.PE455       Location/Qualifiers
FT   CDS_pept        476561..477409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0458"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54767"
FT                   /db_xref="GOA:C6B2E7"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54767.1"
FT                   /translation="MAKRIENFSEISGHYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   AGLAVVLITNSPRLSWQVVEQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGHE
FT                   RNSPLLDGLDIERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAIAAYYEQLGGSTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
     atggccaagc ggatagaaaa cttctcggag atatcaggtc actatgatgt ggtgctctgc        60
     gatgtctggg gcgtcgttca caacggcgtc gatccgttcc cgaaggcggc cgcagccctt       120
     gaagcggcac gcgaggccgg cctcgccgtc gtcctcatca ccaattctcc gcgcctttcc       180
     tggcaggtgg tcgagcagct gcgccagatc ggcgttcccg acagcgccta tgacaggatc       240
     gtcacctctg gcgacgtcac gcgcggcttg atcgccgaag ggccgaagac cgtctttctg       300
     ctcggccacg agagaaatag cccgctcctc gacggcctcg acatcgagcg ccggccggcg       360
     ggcgaagcgc aatcgctggt ctgcaccggc tttttcgacg acgagacgga gaagccggaa       420
     gattacaccg acatgcttct cgatttcaaa gcccgagacg tgccgatgat ctgcgccaat       480
     cccgacctca tcgtcgagcg cggccatcgc atcatcccct gcgccggcgc catagctgcc       540
     tattacgagc agctcggcgg cagcacccgc atcgccggca agccgcatcg gccgatctac       600
     gaggcaacgc ttgcggctgc ccgcgagctt cgcggcgatt tccccgtcga tcgcgtgctg       660
     gcgatcggcg acggcatgcc gaccgatgtg cgcggcgcct tgaattacgg cctcgacctc       720
     ctctacatca gcggcggtat ccacgccaag gaatataccc tcaacggcga gaccgacgag       780
     gcgatcctca acgcctatct cgaacgggaa aacgccgcgc cgaagtggtg gatgccccgc       840
     cttgcatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page