(data stored in ACNUC7421 zone)

EMBL: CP001622.PE456

CP001622.PE456       Location/Qualifiers
FT   CDS_pept        477441..477599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00831 bifunctional riboflavin
FT                   kinase/FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54768"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54768.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVARRPSMAPKKMSDPIGIGLARNWR
FT                   RASCSPG"
     atgactgtct tccaccgcaa tgaaacccgc gaacccttgc ccgcccatct gaagggcggc        60
     gtcgccagaa ggccgagcat ggcaccgaag aagatgagtg atcccatcgg aatcggcttg       120
     gccaggaact ggcgccgggc gtcgtgctcg ccgggttga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page