(data stored in ACNUC7421 zone)

EMBL: CP001622.PE457

CP001622.PE457       Location/Qualifiers
FT   CDS_pept        478291..478515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_6262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54769"
FT                   /db_xref="GOA:C6B2E9"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54769.1"
FT                   /translation="MHVARLLVLTPLFALIVTPAYAYLDPGTGSIIIQSVIGAFAVGAA
FT                   SISLFWQRVKSFLCRTGDNQRQKSGRERK"
     atgcatgtcg caagacttct ggttttaact ccgctttttg ctctcatagt caccccagct        60
     tatgcatatc tcgatccagg cacggggagc atcattatcc aatctgtcat tggagctttc       120
     gccgttggcg cggcttcaat ttcgttgttt tggcaaaggg taaaaagctt cctctgtcgc       180
     accggagaca accagagaca gaaaagcggc cgcgagcgga aatga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page