(data stored in ACNUC7421 zone)

EMBL: CP001622.PE458

CP001622.PE458       Location/Qualifiers
FT   CDS_pept        478512..479879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0463"
FT                   /product="NoeA host specific nodulation protein"
FT                   /note="KEGG: smd:Smed_6261 NoeA host specific nodulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54770"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F0"
FT                   /inference="similar to AA sequence:KEGG:Smed_6261"
FT                   /protein_id="ACS54770.1"
FT                   /translation="MMLSRVSGSFRDPSGHVYEGTEHIYRTVESSAAADYEAARNAGIF
FT                   ESPMIVSTTESTAPSPSKTASYLLEHPRIPLISYPYEWSFSMLKDAALLHLDFHLHLLG
FT                   RGFTLSDATAYNVQFLGPTPVFIDHLSVRRYRDGEYWEGHRQFCEQFLVPLLLRSFFGI
FT                   SHNAWYRGALEGISIADFVKMLRFRQKVSWRVLAHLVLQDKFQRSASAGQAEKAQHRQL
FT                   PRNAYTATLQQLRNWIAGLSPRDTDPTTWANYATANTYSNTEATLKKQFVGDFIRRSGA
FT                   TTVIDLGCNTGDYSEVALHNGAQRVFGFDFDQQALDSAYHRAKNKSLNLLPLFLDARNQ
FT                   SPSQGWLQEERTGFASRAKADAALALAFEHHLAIAHNIPLEQVVDWLISVAPTGVVEFV
FT                   PKDDPTVRTMLALRRDIFPDYNYDHFISLIGRRARVLENLVVSSTGRTLISYSRNG"
     atgatgctat cgcgtgtttc gggctcattt cgcgatccgt caggccatgt ttacgaaggc        60
     accgaacata tatatcggac ggtcgagtca tcggccgctg ctgattatga ggctgccagg       120
     aacgctggca ttttcgaatc accgatgatt gtctcaacca ccgaatcgac ggctccatca       180
     ccgtccaaga ccgcaagcta cttgctggag catccgagaa tacccttaat ttcgtatccg       240
     tacgaatggt cgttttcaat gctgaaagat gcggctcttt tacacctaga tttccatctg       300
     catttgcttg gccgaggttt cacgctatct gatgctactg cctataatgt gcaattcctt       360
     ggcccgacgc cggtttttat agatcacctt tccgttcgtc gctatcgcga cggagagtat       420
     tgggaagggc acaggcagtt ttgcgaacag ttccttgttc cgctactgct tcgatcattc       480
     ttcggcattt ctcacaacgc ctggtaccgt ggcgcgcttg agggaatctc gattgccgat       540
     ttcgtaaaaa tgctgagatt tcggcaaaag gtttcgtggc gcgtcctcgc tcatttggtg       600
     ctccaggata aatttcagcg tagcgcttct gccggacaag ccgaaaaagc acaacatcgc       660
     cagcttcccc gcaacgcata tacggcgacg ctgcagcaac ttcgcaactg gatcgctggc       720
     ttgtcacctc gcgataccga tcccacgaca tgggccaact acgccacggc aaatacttat       780
     agcaatacgg aagcaacact aaaaaaacag ttcgtcggcg atttcatcag acgtagcggc       840
     gctacaacgg tcatagatct tggctgcaac acgggcgact attctgaggt agccttgcac       900
     aatggtgctc aacgcgtctt tggtttcgat ttcgatcagc aagcgctgga cagcgcctat       960
     catcgtgcta aaaacaaatc gctgaatctc ctcccgctat ttctcgatgc tcgaaatcag      1020
     tcgccttcgc agggttggct tcaggaagaa cgaactggtt tcgcgtcaag agcgaaagcg      1080
     gatgccgccc tggcgctcgc attcgagcat cacttagcga tcgcgcacaa catcccgttg      1140
     gagcaggtcg ttgactggtt aatttccgtc gcccccaccg gggtcgtgga attcgtgccg      1200
     aaggatgatc ccacagtacg gacaatgttg gcgctgcgta gggatatttt ccctgactac      1260
     aattatgatc actttatctc gctaattgga cgacgcgctc gtgtgttgga gaatctcgtt      1320
     gtttccagca cgggaagaac gttgatatcc tattccagaa atggatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page