(data stored in ACNUC7421 zone)

EMBL: CP001622.PE459

CP001622.PE459       Location/Qualifiers
FT   CDS_pept        479876..481909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0464"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54771"
FT                   /db_xref="GOA:C6B2F1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F1"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACS54771.1"
FT                   /translation="MTNLAGHTGSWRGHALASALLAVTLFTVALDVYSRNISEFAGSSI
FT                   LQLLPPVLISIVVGCVAFVITGITGFKPVGMSVVLGAATCVIAASQGVTTSVIPPIDGG
FT                   THPYIVSSGRGVVEFILLFVIFLLTAGFAILRLREALMILSGLTFLALLIPIYNLAARD
FT                   RISTSLGPLMTLSRDVNVIHIMFDSLQSDAFKQIAEQQPDLLSEFDGFAYYPDHAGYAN
FT                   WTTLSIAAIQTGRLFFDQHQDGMDPIEEIGEWLRSSSMMSHLADKGWDVSAVQPSNAFC
FT                   FRTKYYCSTLPFLSNSIGQRLGKQRKSNPLIVVDLALLRLAPTLLKPLVYNEGKLLWSD
FT                   ATGPANADSSTANDIALSMDFAKILTEDIAVTDDNPVYKFLHFYPPHKPFILDEDCRIG
FT                   VARTEDWPNYLPQATCAVKQMAGILRALKRLGAYDNSVIIFQSDTGLGMVRPTENADPK
FT                   ITSVVEYSSPQLVGYARPTLLIKPLGATGPLRVSSVQTSHLNTFSLINDATAGRTNLPN
FT                   VTAPKDRSFVVSRIIRAGTTSVSPYEQFIIVGNVADSAAWQYGGMLSRPGVPYLARPIQ
FT                   SATFSIDADEPLNPNQSIRLVGSVSGGNDVEYTFLRRIKDDKLEIIKDWSPDNTATWEV
FT                   DENGKTPCVANILMAARNRVMGPSEHQINVEKVAKISTSACH"
     atgactaatt tggctggcca caccggatcg tggagaggcc acgctcttgc ctcagcgctt        60
     ctagctgtaa ctctgtttac ggtcgcgcta gatgtctatt ccagaaacat cagtgagttc       120
     gctggaagct ccatcttaca gctcctgccg ccggtgctca tatccatcgt tgtagggtgt       180
     gtggcttttg tgatcactgg cattacgggc ttcaagcccg ttgggatgtc ggtggtgctc       240
     ggggctgcta cttgtgtgat agcagcgagt caaggagtca cgacaagcgt tataccgcct       300
     atcgatggcg gtacccatcc ttatatcgtt agtagcggga ggggcgtggt cgaattcatc       360
     ctgcttttcg tcattttctt attgacggca ggcttcgcaa tcttgcggct tcgcgaagca       420
     ttgatgatcc tctccggatt gactttccta gccctattaa ttcccatcta caacttggcg       480
     gcccgcgatc ggatatcgac ttctctcggt cccctgatga ccctttctcg cgacgtcaac       540
     gtcattcaca ttatgttcga tagccttcaa tcggatgctt tcaaacaaat tgctgagcaa       600
     cagccggatc tattgtctga atttgatggt tttgcctatt atccggacca cgcgggctat       660
     gcgaactgga cgacgctctc catcgctgcc attcagactg ggcggctgtt cttcgaccag       720
     catcaggacg gtatggatcc gatagaagaa atcggtgaat ggcttcgctc gagcagcatg       780
     atgtctcacc tcgccgacaa gggctgggat gtcagcgccg tccagccatc gaatgccttc       840
     tgcttcagga ccaagtatta ctgctcgaca ctaccgtttc tttctaattc aattggacaa       900
     cgtcttggga agcagcgcaa atcaaatccg ttgattgttg tcgatctcgc gctgttacgc       960
     ctggcgccga ccttgctgaa gccgctcgta tataatgagg ggaaactgct ttggtctgat      1020
     gcgacaggac cagcgaacgc ggatagcagc actgccaacg acatcgcctt gtcgatggac      1080
     tttgcgaaaa tattgacgga agacatcgcc gttacagatg acaatccagt gtataaattt      1140
     ctgcatttct atccgccgca caaacccttt attcttgacg aggactgtcg gataggtgtt      1200
     gccagaacgg aagattggcc gaactatttg ccgcaagcta cgtgtgcggt taagcagatg      1260
     gccggtatcc tgcgggcact taagcgctta ggtgcatacg acaacagcgt tatcattttc      1320
     cagtcagata ctggacttgg gatggtgcga cccactgaaa atgccgatcc gaagataacc      1380
     tctgtcgttg agtattcctc ccctcagtta gttgggtacg cacgtccaac actgttaata      1440
     aagccgcttg gcgctacagg gcctctacgg gtttcttcgg tgcaaacaag ccatctgaac      1500
     acgttctcct tgatcaacga tgctaccgca gggcgtacaa atcttccaaa cgtgacagct      1560
     cccaaagacc ggagcttcgt cgtgagtcgt atcatccgtg ctggcacgac gtcggtctcg      1620
     ccttatgaac agttcatcat agtcgggaat gtggctgact cggcagcatg gcaatacggt      1680
     gggatgctat ctcgccccgg agttccctac cttgcgcgcc ccattcaatc agccacgttc      1740
     tcgatcgacg cagacgaacc actcaatcct aaccaatcaa taaggctcgt gggttcggtc      1800
     agcggcggca acgatgtcga atatactttc ctacgtagaa ttaaggatga caagctcgag      1860
     attatcaagg actggtcccc cgacaatact gctacatggg aggtcgatga aaacggcaag      1920
     acgccgtgcg tcgccaatat attgatggca gcgcgcaatc gagtcatggg gccttcagag      1980
     caccagatca acgtcgaaaa ggtggcgaaa atatccacgt ctgcatgcca ttga            2034
//

If you have problems or comments...

PBIL Back to PBIL home page