(data stored in ACNUC7421 zone)

EMBL: CP001622.PE46

CP001622.PE46        Location/Qualifiers
FT   CDS_pept        complement(43656..46382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0047"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: ret:RHE_CH00388 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54358"
FT                   /db_xref="GOA:C6AYD4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD4"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACS54358.1"
FT                   /translation="MNARIDTGNEAFSAAELATAESRASATPMMEQFIEIKANNPGSLL
FT                   FYRMGDFYELFFEDALEASRALGITLTKRGQHMGQDIPMCGVPVHAADDYLQKLISLGF
FT                   RVAVCEQIEDPAEAKKRGAKSVVKRDVVRLVTPGTITEEKLLSPSESNYLMALTRIRAS
FT                   GEALLALAWIDISTGVFRLAETEASRLLADILRIDPRELILPDTIFHDPELKPVFDVLG
FT                   RTAVPQPSVLFDSASAEGRIARYFGVATLDGFGTFSRAELAAAAAAVAYVEKTQIAERP
FT                   PLGKPERESAASTLFIDPATRANLELARTLSGDRNGSLLKAIDRTVTGGGARLLAERLM
FT                   SPLTDPARINARLDSIGFLIDEPLLCGNLRDTLKHVPDMPRALSRLALDRGGPRDLWAI
FT                   RQGLEAAGGIAAMLGKAMLPEELGQALSGLQALPAAVEKLLAETLADELPLLKRDGGFL
FT                   RDGASAELDEVRALRDQSRRVIAGLQLQYAEETGIRSLKIKHNNVLGYFIEVTAGNASP
FT                   MTETAEAKARFIHRQTMANAMRFTTTELADLESRIANAADQALTIELEAFDRMTAAVVA
FT                   EAEAIKSGARALAVIDVAAGLALLAEEQAYCRPQVDGSKMFAIEGGRHPVVEQALRRQA
FT                   GGPFVANHCDLSPRTGDRDGAIWLLTGPNMGGKSTFLRQNALISILAQMGSFVPATSAH
FT                   IGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSLVILDEIGRGTATFDGL
FT                   SIAWAAVEHLHEANRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWDGDVIFLHEVGP
FT                   GAADRSYGIQVARLAGLPASVVARARDVLTRLEDADRKNPASQLIDDLPLFQVAVRREE
FT                   TARGTSKVEEALKAMSLDDMTPREAMDALYDLKKKLK"
     gtgaacgctc gaatagacac agggaatgaa gccttttcgg ctgccgagct cgccacggcg        60
     gaaagccgtg cctcggcgac gccgatgatg gagcaattta tcgagatcaa ggcgaacaat       120
     ccgggttcgc tgctgttcta tcgcatgggc gatttctacg agctgttctt cgaggatgcg       180
     ctggaagctt cacgcgcgct cggtatcacg ctgacgaagc gcggccagca catgggccag       240
     gatatcccga tgtgcggggt tccggtgcat gcggccgacg attatctgca gaagctgatt       300
     tcgctcggct tccgcgtcgc cgtctgcgag cagatcgaag atccggccga agcaaaaaaa       360
     cgcggcgcga aatccgtcgt caagcgtgac gtcgtccgcc tcgtcactcc aggcacgatc       420
     accgaggaaa agctgctttc gccctcggaa tccaactatc tgatggcgct gacccgcatt       480
     cgcgccagcg gcgaggcctt gctggcgctt gcctggatcg atatttccac cggcgtcttc       540
     cggcttgccg agaccgaagc ctcgcgcctg cttgccgata tcctgcgcat cgatccgcgt       600
     gagctcatcc ttcccgacac gatcttccac gatcccgaac tcaaaccggt cttcgacgtg       660
     ctcggccgga cagccgtgcc gcagccttcc gtgctcttcg acagcgccag cgccgaaggc       720
     cggatcgcgc ggtatttcgg cgtcgcgacg ctcgacggct tcggcacctt ctcacgcgcc       780
     gagctggcag cggccgcggc cgccgtcgcc tatgtcgaga agacgcagat tgccgagcgg       840
     ccgccgcttg gaaaaccgga acgggaaagt gcagcctcga cgctgttcat cgatcccgcc       900
     acccgcgcca atctggagct tgcccgcacg ctttccggcg atcgcaacgg ttcgctgttg       960
     aaggcaatcg accgcaccgt caccggcggc ggcgccaggc ttcttgccga acggctgatg      1020
     tcgccgctga ccgacccggc ccgcatcaat gcgcggctcg attcgatcgg tttcctgatc      1080
     gacgaacccc tgctttgcgg caatctgcgc gacacgctga aacatgttcc cgacatgccg      1140
     cgcgctctgt cgcgcctggc gctcgaccgc ggcggcccgc gcgatctctg ggcgatccgc      1200
     cagggcctcg aagcggcggg cggaattgcg gcgatgctcg gcaaggcgat gctgcccgaa      1260
     gaactcggcc aggcgctatc cgggctgcag gcccttcccg cggcagtgga aaagctgctt      1320
     gccgaaacgc tcgccgacga attgccgctg ttgaaacgcg atggcggctt ccttcgcgac      1380
     ggcgccagcg ccgagctcga cgaggtccgg gcactgcgcg accagtcccg tcgcgtcatc      1440
     gccggcctgc aattgcaata tgccgaggag accggcatcc ggtcgctgaa gatcaagcac      1500
     aacaacgtcc tcggttattt catcgaagtc accgccggca atgcctcgcc gatgacggag      1560
     acggcggagg cgaaggcccg cttcatccac cgccagacga tggcgaacgc catgcgcttc      1620
     accacgaccg aacttgccga tctcgaaagc cgcatcgcca atgccgccga ccaggcgctg      1680
     acgatcgaac tcgaagcctt cgacaggatg acggcggccg tcgttgcgga agccgaggcg      1740
     atcaagtcgg gcgcccgggc gcttgccgtc atcgacgtcg ccgcaggctt ggcgcttctc      1800
     gccgaggagc aggcctattg ccgcccgcag gtcgacggct cgaagatgtt tgccatcgag      1860
     ggcgggcgcc atccggtcgt cgagcaggcg ctgcggcggc aagcgggcgg ccccttcgtc      1920
     gccaatcatt gcgatctgtc gccgaggacc ggcgaccggg acggggcgat ctggctgctg      1980
     accggcccga acatgggcgg caagtcgacc ttcctgcgcc agaacgcgct gatatcaatc      2040
     ctggcgcaga tgggctcctt cgtgccggcg acatcggccc atatcggcat cgtcgaccgg      2100
     cttttctcgc gcgtcggcgc ctccgacgat ctggcgcgtg ggcgctcgac cttcatggtc      2160
     gagatggtcg aaacggcggc gatcctcaac caggcgagcg accgttccct cgtcatcctc      2220
     gacgagatcg gccgcggcac cgccacgttc gacggtcttt cgatcgcctg ggccgccgtc      2280
     gagcacctgc atgaggccaa tcgctgccgc ggcctcttcg ccacgcattt ccacgaactg      2340
     accgtgcttt cggaaaagct tggccggctg tcgaacgcga cgatgcgcgt caaagaatgg      2400
     gacggcgacg tcatcttcct gcacgaggtc gggccgggtg cggcggaccg ctcctacggc      2460
     atccaggtcg cgcgccttgc cgggcttccg gcctcggtcg tggcgcgcgc ccgcgacgtg      2520
     ctcacccggc tggaagatgc cgatcgcaag aacccggcga gccagttgat cgacgacctg      2580
     ccgctcttcc aggtggcggt gcgccgcgag gaaaccgccc gcgggacctc caaggtcgag      2640
     gaggcactga aggcgatgag ccttgacgac atgacaccgc gcgaggcaat ggatgcgctt      2700
     tacgacctca agaagaagtt gaaatag                                          2727
//

If you have problems or comments...

PBIL Back to PBIL home page