(data stored in ACNUC7421 zone)

EMBL: CP001622.PE460

CP001622.PE460       Location/Qualifiers
FT   CDS_pept        complement(482935..483201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0466"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   oan:Oant_4528 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54772"
FT                   /db_xref="GOA:C6B2F2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS54772.1"
FT                   /translation="MKRNRFTDEQIIGILKEHEAGTPVSELCRKHGVSDASIYKWKAKF
FT                   GGMEVSEAKRLKTLEDENTKLKRLLADAMLDNAALKDLLGKKW"
     atgaagcgca atcgtttcac agacgaacag atcatcggca tattgaagga gcacgaggca        60
     ggcacgccgg tctcggagct ttgccgcaag catggcgtca gcgatgctag catctataaa       120
     tggaaggcca aattcggcgg catggaggta tccgaagcca agcgactgaa gacgctggag       180
     gacgagaaca cgaagctgaa gcggcttctg gcagatgcca tgctcgacaa tgccgctttg       240
     aaagaccttt tgggaaagaa gtggtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page