(data stored in ACNUC7421 zone)

EMBL: CP001622.PE461

CP001622.PE461       Location/Qualifiers
FT   CDS_pept        483756..488366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0467"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /note="TIGRFAM: Ti-type conjugative transfer relaxase TraA;
FT                   PFAM: MobA/MobL protein; KEGG: rec:RHECIAT_PC0000882
FT                   conjugal transfer protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54773"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F3"
FT                   /inference="protein motif:TFAM:TIGR02768"
FT                   /protein_id="ACS54773.1"
FT                   /translation="MAIMFVKARVISRGAGRRIVPAAAYRHRARMMDEQAGTSFSYRGG
FT                   RAELVHEELALPTQVPEWLRTAIDCRTVAAASEALWNAVEAFEKRPDAQLARELIIALP
FT                   EELTQAENIALVREFVHDNLTSRGMVADWVYHDKDDNPHIHLMMTLRPLKEEGFGAKTV
FT                   QVLDEGGKPLRVVTLDRPKGRIVSKAWAGDKETMKGWKIAWADTANRHLAFAGHEIRLD
FT                   GRSYAEQGLDGIAQRHLGPEKAAHSRRGRQPYYASAGLARRQGVVDRLLSEPEFLLKRL
FT                   GNERSTFDERDIAKALHRYVDDPSDFANIRARLMASDDLVMLKPQEVDPETGNASEPAV
FT                   FTTREILRIEYDMARSAQVLSEHKGFAVPSRYIAAAVKSVEAGDLDKPFKLDAEQINAI
FT                   SHITGDSGIAAVVGLAGAGKSTLLAAARVAWEGEGRRVIGAALAGKAAEGLEDSSGIRS
FT                   RTLAAWELIWANGHETLRRGDVLVVDEAGMVSSQQMARVLKIAEDAGTKVVLVGDAMQL
FT                   QPIQAGAAFRAITERIGFAELAGVRRQRQQWAREASRLFARGEIEKGLDVYAQQGHLIE
FT                   AGTRDEVIGRIVGDWSEARRQAIETSVLKVNGGRLRGDELLVLAHTNQDVKRLNEALRS
FT                   VISDAGALGENRSFRTERGAREFAAGDRIIFLENARFLEPRAPRLGPQYVKNGMLGTVV
FT                   STGDKRGDTLLSVRLDNGRDVVISEDSYRNVDHGYAATIHKSQGATVERTFVLATGMMD
FT                   QHLTYVSMTRHRGRADLYAAKEDFEAKPEWGRKQRADHAAGVTGELVESGQAKFRPNDE
FT                   DADDSPYADVRTDDGTVHRLWGVSLPKALEEGGVSEGDSVTLRKDGVEKVKVQVPVVDE
FT                   QTGQKRYEEREVDRNVWTAKRIETAEARLERIEQESHRPHVFKQLVLRLSRSGAKTTTL
FT                   DFESEASYQAHADDFARRRGIDTLSQTAAGMEEGVSRRLAWIAEKREQVAELWERASVA
FT                   LGFAIERERRVSYNEARIETQTVSDADAGGVRYLIAPTTEFARSAEEDARLAQLSSLAW
FT                   KEREAILRPLLEKIYRDPDAALVALNAMASDVKIEPRRLADDLAAAPDRLGRLRGSDLI
FT                   VDGRAARDERSIATAALTELIPLARAHATEFRRNAERFGVREQQRRAHMSLPIPALSRQ
FT                   VMARLVEIEAVRERGGDDAYKTAFALATEDRSLVQEVKAISEALTERFGWSAFTSKADA
FT                   VAERNMVERMPEDLTGMRGEKLTRPFEAVKHFADEQHLVERRDRSKIVAGANADPEREN
FT                   VPMLAAVTEFKTPIDEEARSRALATPLYRQQRVALAAVASAIWRDPAGAVGKIEELLQK
FT                   GFAAERIAAAVTNDPAAYGALRGSNRLMDRMLASGRERKAAVQATPEVAARLRSLGSAY
FT                   VNVLNAERQAIAEERRRMAVAIPGLSKAAEEVLTRLAAESKSNARKLNASAFFLDPNIR
FT                   QEFAAVSRALDERFGRDAILRQAKDRINRVPPPHRTAFEAMQDRLKILQQAVRIESSDR
FT                   IISERRQRTANRGVDL"
     atggcgatta tgttcgtcaa agcacgggtg atcagtaggg gggctggacg gaggattgtc        60
     ccggccgcgg cctatcgcca tcgcgcccgg atgatggacg aacaggccgg cacgtccttc       120
     agctaccgag gcgggagggc cgaactggtg catgaggagc tggctttgcc gacgcaggta       180
     ccggaatggc tgcgcacggc aatcgattgc cgcaccgttg cagcggcgag cgaggcgctg       240
     tggaatgccg tggaggcgtt cgaaaaacgg ccggacgcgc agctcgcccg cgaactgatc       300
     atcgcgctgc cagaggagtt gacgcaagcc gaaaacatcg cgctggtgcg cgaattcgtc       360
     catgacaacc tgacctcgag ggggatggtt gcggactggg tctatcacga caaggacgac       420
     aacccacaca tccatttgat gatgacattg aggcccttga aggaggaggg cttcggcgcg       480
     aagacggttc aagtgctcga cgaaggcggt aagccgctgc gcgtggtcac gctcgaccgg       540
     ccgaagggca ggatcgttag caaggcctgg gccggcgaca aggaaaccat gaagggctgg       600
     aagatcgcct gggcggacac ggccaaccgg cacctggcgt ttgccggcca cgagatccgg       660
     ctcgatggcc gctcctatgc cgagcagggt ctcgatggca tcgcgcaaag acatctcggt       720
     ccggagaagg cagcacactc ccgcaggggc aggcaacctt attacgcgtc ggccggtctt       780
     gcccggcggc aaggggtggt cgatcggctg ctctccgaac cggagtttct gttgaagcgg       840
     ctcgggaatg aacgctccac cttcgatgag cgcgatattg ccaaggctct gcatcgatat       900
     gtcgacgatc cttcggactt cgctaatatc cgcgcgcggc tgatggcgtc ggacgacctg       960
     gtcatgttga agccgcagga ggtcgatcct gaaacgggta atgcgtcgga acccgctgtc      1020
     ttcaccacgc gcgagatact gcgcatcgag tatgacatgg cgcggtcggc acaggtgttg      1080
     tcagagcaca aaggttttgc cgttccgtca cggtatatcg cggccgccgt caaaagcgtc      1140
     gaagctggcg atctcgacaa acccttcaag ctcgatgcgg aacagatcaa tgccatcagt      1200
     catatcaccg gtgacagcgg cattgctgcg gtggtcggcc ttgccggtgc cggcaagtcg      1260
     accctgcttg ccgcggcacg tgtcgcctgg gaaggcgaag gtcgccgggt gatcggcgcg      1320
     gcccttgcgg gcaaggccgc tgaggggctg gaagacagtt ccggcatcag gtcgcgaacg      1380
     ctcgccgcct gggaacttat atgggccaat ggacacgaga cgctccgtcg tggtgatgtg      1440
     cttgtcgtcg acgaggccgg aatggtgtcg tcgcagcaga tggcgcgtgt gttgaagatt      1500
     gctgaagatg caggcaccaa agtcgttctg gtcggcgatg cgatgcaact gcagccgatc      1560
     caggcgggtg cggcgttccg ggcgatcacc gagcggatcg gttttgccga actcgccggc      1620
     gtacgacggc agcgccagca atgggcgcgc gaggcgtcgc ggctctttgc tcgtggcgag      1680
     atcgagaaag gtctcgacgt ctatgcgcag cagggccatc tcatcgaggc tgggacacgg      1740
     gacgaagtca tcgggcggat tgttggcgat tggagcgaag cgcgccgaca ggcgatcgag      1800
     acgtcggtcc tcaaagtcaa tggtggccgt cttcgcggcg atgagctgct ggtactcgcc      1860
     cacacaaatc aagacgtgaa gcgtctgaac gaggcactgc gatcggtgat atcggacgcg      1920
     ggcgcgctgg gtgagaaccg ctctttccgg accgaacgcg gagcgcggga attcgccgcc      1980
     ggcgaccgca tcatcttcct ggagaatgcc cgtttccttg agccacgtgc tccccgtctc      2040
     ggcccgcaat atgtgaagaa cggcatgctc ggcacggtcg tttccaccgg cgacaaacgt      2100
     ggcgacacac tgctgtcggt ccgtctcgac aatggccgcg atgtcgtcat cagtgaggac      2160
     agctatcgca atgtcgatca tggctacgcc gcgaccatcc acaaatcaca aggtgccacc      2220
     gtcgagcgaa ccttcgtgct cgccaccggc atgatggacc agcacctgac ctatgtgtcg      2280
     atgacccggc atcgcggccg cgcagacctc tatgccgcga aggaagactt tgaagcgaag      2340
     ccggaatggg gacgaaagca gcgtgccgat catgccgccg gcgtgaccgg tgagctcgtg      2400
     gaaagcggac aagccaagtt ccggccgaat gacgaggatg ccgacgacag tccttatgcc      2460
     gacgtcagaa cggatgacgg aaccgtccat cgtctctggg gtgtgagctt gccgaaggcg      2520
     ctcgaagaag gtggtgtctc agaaggcgac tcggtgaccc tgcgcaagga cggtgtcgag      2580
     aaggtcaagg ttcaggttcc ggtcgtcgat gaacaaaccg ggcagaagcg ttacgaggaa      2640
     cgtgaggtcg accgcaatgt ctggaccgcc aaacgcatcg aaaccgccga agcccgcctg      2700
     gaacgcatcg agcaggaaag ccatcggccg catgtgttca agcagttggt cctgcgcctg      2760
     tcgcgctccg gtgccaagac gacgacactc gatttcgaga gcgaggccag ctaccaggct      2820
     catgccgacg atttcgcccg gcgtcgtggg atcgacactc tttctcaaac tgcggccggc      2880
     atggaggaag gcgtctcccg ccggttggcg tggattgccg agaagcgcga gcaggtggct      2940
     gagctctggg agcgggccag cgttgcgctc ggatttgcga tcgagcggga acggcgtgtt      3000
     tcgtacaatg aggcgcgaat tgaaacgcaa actgtctcgg atgcagatgc tggcggtgtg      3060
     cggtatctga tcgcacccac cacggaattc gccagaagcg cggaggaaga tgcgcgcctg      3120
     gctcagcttt cttcgctggc gtggaaggaa cgggaagcca tcctgcggcc gctgttggag      3180
     aagatctatc gtgacccgga tgcagcactt gtcgccctga acgccatggc atcggatgtg      3240
     aagatcgaac cccgcaggct tgccgacgat cttgccgcag cgccggatcg gctcggccgc      3300
     ctgcgtggtt ccgatctgat cgtcgacggc cgtgcggcac gcgacgagcg cagcatcgcg      3360
     accgcggcat tgacggaact gataccgttg gcccgcgccc atgcgacgga gttccgcagg      3420
     aatgctgaac ggtttggtgt ccgtgagcaa cagcgccgcg ctcacatgtc attgccgatc      3480
     ccggctcttt ccaggcaggt gatggcgcgt ctcgtagaga tcgaagcagt gcgagaaagg      3540
     ggtggtgacg acgcctacaa gaccgccttt gcgcttgcca ccgaagaccg ctcgctcgtg      3600
     caggaggtca aggcgatcag cgaggcgctg acggaacgct tcggctggag cgccttcaca      3660
     tccaaagccg atgcagttgc cgaacgcaac atggtcgagc gtatgccgga agacctcaca      3720
     ggcatgagag gcgagaagtt gacccggccg tttgaagccg tgaagcattt tgccgacgag      3780
     cagcatctcg tcgagcggcg ggatcgttcg aagattgttg ccggcgccaa tgccgatccc      3840
     gagagggaga atgtccccat gctcgccgca gtcaccgaat tcaagacccc gatcgacgag      3900
     gaggcgagat cgcgcgctct cgccacgccg ctgtatcgcc agcagcgcgt agcgctggcg      3960
     gccgtggcaa gcgcgatctg gcgcgatccg gccggcgccg tcggcaagat cgaagagctg      4020
     ctccagaaag gttttgctgc cgagcgcatc gccgcggctg tgaccaacga tccggccgcc      4080
     tatggtgcgc tccgcggctc caatcgcctc atggaccgga tgctggcttc tggccgggag      4140
     cggaaggcgg cagtgcaggc cacgcctgaa gtcgccgctc gcctgcggtc actcggttcg      4200
     gcctacgtca atgtgctcaa tgccgaacgc caggctattg ccgaagaacg acggcgcatg      4260
     gcagtcgcca ttcccggcct ctcgaaggcg gcggaagagg tactcacgcg gctagctgcc      4320
     gagtcgaaga gcaacgctcg caagctgaac gcatcggcct tttttctcga tccaaatatt      4380
     cgccaggaat ttgccgctgt cagcagggcg ctcgacgagc gctttggtcg tgatgcgatc      4440
     ctccgccaag cgaaggatcg catcaaccgt gttccaccgc cacatcgcac ggccttcgag      4500
     gcgatgcagg acaggctgaa aatcctgcag caggccgttc gtattgaaag cagcgacagg      4560
     attatctcgg agcggcgcca gcgcaccgcc aaccgcggcg tcgatctcta a               4611
//

If you have problems or comments...

PBIL Back to PBIL home page