(data stored in ACNUC7421 zone)

EMBL: CP001622.PE462

CP001622.PE462       Location/Qualifiers
FT   CDS_pept        complement(488419..489333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0468"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   SMART: HEPN domain protein; KEGG: sme:SMa0967 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54774"
FT                   /db_xref="GOA:C6B2F4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F4"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACS54774.1"
FT                   /translation="MKSNLDHLPERKQRELARVVDILHEEFQDALKDSSAEFKKMGRIL
FT                   KVILFGSYARGDWVDEPHTLKGYRSDYDLLVIVNNRKLSDFATYWYKAADRFLHDPGIK
FT                   TPVSLIVHSRREVNTALHEGQYFFSDIRREGIVLYELDDEPLPEPKPRSKAEEYLIAKE
FT                   HFEERFPFSTDLLDGFTLYVERRRYKHAAFFLHQVIEHAYSAALLTLSNYSPASHNLTF
FT                   LRKLAEGRDRRLVDAWPRDQQRYRAWFNTINEAYVKARYSNHYEVSEEALIWLGEQTAE
FT                   LHVLVKIVCKEHLTRLRTDATDY"
     atgaaatcca acctcgacca cctgcccgaa cgcaaacagc gcgagcttgc ccgcgttgtc        60
     gatatcctgc atgaggaatt tcaggatgca ctcaaggaca gctcagcgga gttcaagaaa       120
     atggggcgga tcctcaaggt catcttgttt ggatcatatg ctcgcggtga ctgggttgac       180
     gagccgcaca cgctcaaggg ctatcgttct gattatgatc tgctggtaat cgtcaacaac       240
     aggaagctgt ctgacttcgc cacgtattgg tataaggcgg cggaccgctt tctccacgat       300
     cccggcatca aaacgccggt tagcctcatt gttcactcgc ggcgcgaggt caacacggcg       360
     cttcacgagg gacaatactt cttctcagac atccgccgcg aggggatcgt tctttatgaa       420
     ctcgatgatg aaccgctgcc cgaaccgaag ccacgctcta aggccgagga gtacctaatc       480
     gccaaggagc attttgaaga gagatttcca ttctcaactg acttgttgga tggattcacg       540
     ttatacgttg aaaggcggcg ctacaaacac gcagcctttt tcctccatca agttattgag       600
     catgcttact cggctgcact tttgacgtta tccaattata gccccgcctc ccataatctg       660
     actttcctgc gtaagttggc ggagggccgt gatcgtcgcc tcgtggatgc ctggccgcgt       720
     gaccagcaac gctatcgcgc ctggttcaat acgatcaatg aagcatacgt aaaggcgcgt       780
     tattcgaatc actatgaagt cagcgaagag gcgttgatct ggctcggaga acagacagcc       840
     gaactgcatg tgctggtcaa aattgtatgc aaggaacatc tcacgagact tcgaacagac       900
     gctacagatt attga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page