(data stored in ACNUC7421 zone)

EMBL: CP001622.PE466

CP001622.PE466       Location/Qualifiers
FT   CDS_pept        491527..492828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0472"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: ret:RHE_CH00788
FT                   exopolyphosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54778"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F8"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACS54778.1"
FT                   /translation="MMEQAGAADHAARSDGDSAPSRRNRRKHRGKRGLQGRPLTPAKPS
FT                   GAPQQERRAEETALGGELRETLNGASANRRGRQESHAHPGHQGDRQAGEHVWPEELYAA
FT                   LDLGTNNCRLLIAQPTRPGQFRVVDAFSRIVRLGEGLAASGRLSDEAMERAIEALRICA
FT                   SKLRNREIRRMRLIATEACRQAVNGEEFLSRVVAETGLALEIIDRETEARLAVSGCSSL
FT                   VGRETRSVVLFDIGGGSSEIAVIRIGDNRFSRLANHITHWTSLPVGVVTLSERHGGHDV
FT                   TPEAFEGMVREVEGMLGSFDCPEIEVAQTGDFHLIGTSGTVTTLAGVHLDLPRYDRRKV
FT                   DGIWLSDDEVSAMQAKLLSWDFASRAANPCIGPDRADLVLAGCAILEAIRRRWPSPRMR
FT                   VADRGLREGLLTDMMADDGVWRRNRNRRGQRVRS"
     atgatggaac aggccggagc ggcagatcat gccgcccgct ccgatggcga ttcggcgccg        60
     agccgtcgca accgccgcaa gcatcgcggc aagcgcggtc tgcagggccg gccgctaaca       120
     ccggcaaaac catcaggtgc cccgcagcag gaacgccgcg cggaagagac ggcgctcggt       180
     ggcgaactgc gtgaaacact gaatggcgcg agcgccaacc gcaggggtcg ccaggaaagc       240
     catgcccatc ccgggcatca gggggatcgt caggccggcg aacatgtgtg gccggaggag       300
     ctctatgctg ccctcgatct cggcaccaac aattgccgtc tcctcattgc ccagccgact       360
     cgtccgggac aatttcgcgt cgtcgacgcc ttttcccgca tcgtgcgcct cggcgaaggt       420
     cttgcggcca gcggccgtct gtccgatgag gcgatggaga gggcgatcga ggcgctgagg       480
     atctgcgcct ccaagctcag gaaccgggag atccgccgca tgcggctgat cgccaccgaa       540
     gcctgccgcc aggccgtcaa tggcgaggaa ttcctcagcc gggtcgttgc cgaaaccggc       600
     ctcgcgcttg agatcatcga tcgcgagaca gaggcgcggc ttgccgtctc cggctgctcc       660
     tcgctggtcg gtcgcgagac gcgctccgtc gtgctcttcg atatcggcgg cggctcgtcg       720
     gagattgccg tcatccgcat cggcgacaat cgcttcagcc gccttgccaa tcacatcacc       780
     cactggacct cgttgccggt cggcgtcgtg accctgtcgg agcgccatgg cgggcacgac       840
     gtcacgccgg aggccttcga aggcatggtg cgtgaagtcg aaggcatgct tggaagcttc       900
     gattgcccgg agatcgaggt cgcccagacc ggcgactttc acctgatcgg cacatcgggc       960
     acggtgacaa cgcttgccgg cgtgcatctc gacctgccgc gttatgaccg gcgcaaggtc      1020
     gatggcatct ggctgtccga cgacgaggtc tccgccatgc aggcaaagct gctctcctgg      1080
     gatttcgcaa gccgcgccgc caatccctgc attgggcccg atcgggccga tctggtgctc      1140
     gccggctgcg ccattctcga ggcgatccgc cgccgttggc cgagcccgcg catgcgggtt      1200
     gccgatcgcg gcttgaggga aggtctgctc accgacatga tggccgatga cggcgtgtgg      1260
     cggcgcaatc gtaaccgccg cggccagcgc gtgagatcgt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page