(data stored in ACNUC7421 zone)

EMBL: CP001622.PE467

CP001622.PE467       Location/Qualifiers
FT   CDS_pept        492843..493562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0473"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: rec:RHECIAT_CH0000875 ribosomal RNA
FT                   methyltransferase/cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54779"
FT                   /db_xref="GOA:C6B2F9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F9"
FT                   /inference="protein motif:PFAM:PF01728"
FT                   /protein_id="ACS54779.1"
FT                   /translation="MTKAPIAGNRTGRKLGQRVKNKKMKASSRQWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHHILRGARRIIDLGAAPGSWSQIAAKVTGSTDDDIRVAAID
FT                   FLEMTQLPGVKILQLDFLDPTAPEKLLEAVGGTPDLVISDMAAPTTGHHRTDHLRTMHL
FT                   CEVAAHFAVEVLGEGGHFLTKTFQGGTERELLAMLKQNFRQVVHVKPNSSRAESVEMFL
FT                   LAKGFKGRKAEGNAEEA"
     atgaccaagg caccgatcgc gggaaaccgc accggccgca agctcggcca gcgcgtcaag        60
     aacaagaaga tgaaggcctc ctcccgccaa tggctggagc gccacatcaa cgatccctat       120
     gtgcaacgcg cccagcttga aggctatcgc gcccgggccg ccttcaagct gctggagatc       180
     gacgagaaac atcacatcct gcgcggcgcc aggcgcatca tcgatctggg ggccgctccc       240
     ggcagctggt cgcagatcgc cgccaaggtc accggctcga cggatgatga tattcgtgtg       300
     gctgcgatcg atttcctcga aatgacccag ctgccggggg tcaagatcct gcagctcgat       360
     ttcctcgatc cgacagcgcc ggaaaagctg ttggaggccg tcgggggcac gcctgatctc       420
     gtcatctccg acatggcggc gcccaccacc ggccaccacc gcaccgacca tctgcgcacc       480
     atgcatctgt gcgaagtcgc ggcccatttc gccgtcgaag tcctggggga gggcgggcac       540
     ttcctgacca agacctttca gggcggcacc gagcgtgagc tgctcgccat gctcaagcag       600
     aatttccgcc aggtcgtcca tgtcaaaccg aactcgtcgc gcgccgaatc agtcgagatg       660
     ttcctgctgg ccaaggggtt caagggacgc aaggccgaag gcaacgcaga ggaagcttga       720
//

If you have problems or comments...

PBIL Back to PBIL home page