(data stored in ACNUC7421 zone)

EMBL: CP001622.PE468

CP001622.PE468       Location/Qualifiers
FT   CDS_pept        493720..494103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0474"
FT                   /product="putative lactoylglutathione lyase protein"
FT                   /note="KEGG: ret:RHE_CH00791 putative lactoylglutathione
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54780"
FT                   /db_xref="GOA:C6B2G0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00791"
FT                   /protein_id="ACS54780.1"
FT                   /translation="MLLYVTLGTNDLYRAGHFYDAVLSPLGYRRQRSSEEEIGYSAEGD
FT                   TRCRFWVVTPFNHRRATSGNGAMVALAAETRADVDAFHAAAIAAGAVDEGEPGLRSYHA
FT                   QFYAAYVRDLDGNKLSAVCENPQ"
     atgcttcttt acgtcacgct cggaaccaac gacctttatc gcgcagggca tttttatgat        60
     gccgtgctgt ctcccctcgg ctatcgccgt cagcgctctt ccgaagagga aatcggctat       120
     tccgccgagg gcgatacgcg ctgccgcttc tgggtggtga cgccgttcaa tcaccgccgg       180
     gcaacctcag gcaatggcgc catggtggcg cttgcagccg aaacgcgggc tgatgtcgat       240
     gccttccatg cggcggcaat cgcggcaggc gccgtggatg agggcgagcc cggcctgcgc       300
     tcctaccatg cccaattcta tgccgcctat gtgcgtgatc tcgacggtaa caagctctct       360
     gcggtctgcg aaaacccgca gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page