(data stored in ACNUC7421 zone)

EMBL: CP001622.PE469

CP001622.PE469       Location/Qualifiers
FT   CDS_pept        complement(494189..495613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0475"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00792 efflux transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54781"
FT                   /db_xref="GOA:C6B2G1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54781.1"
FT                   /translation="MNRIVPLILAVALFMEQMDSTVIATALPAIAADLNVGPITLKLAL
FT                   TSYMVALAVFIPVSGWMADRFGAKKIFRLAISVFVIGSIFCAISSNLVEFVFARFLQGM
FT                   GGAMMTPVGRLVLVRTTQRSDLVSAMALLTIPALVGPLTGPPLGGFITTYFSWHWIFLI
FT                   NVPVGIIGISLATIFLPEVEATAPPRLDFTGFVLTSLSAAGVVFGLSVVSLPALPPIIG
FT                   VTATLIGLICGVLYVRHAKRHPAPILNLNLFKNPTFRASTLGGMLFRICVGAMPFLTPL
FT                   MLQLGFGLTPFQSGLITFAGAIGAITTKFMAKRVFAAAGFRTTLLGAAMVTTLVTVVTG
FT                   LFTPSTPHLVIIGVLLLGGFSRSFMFTGVNALAFADIDDAEASQATSMSSVMQQVSLAL
FT                   GVAVAAAILESSIYFRGEALQVADFHLAFYIIAGLTVIATIPFIRMDRNAGALVSGHRL
FT                   KTMTAATVEAEQHAVK"
     atgaatcgca tcgtcccgct gatccttgcc gtcgccctct tcatggaaca gatggactcg        60
     actgtcattg cgacggcgct gccggcgatc gcggcggatc tcaatgtcgg gccgatcacg       120
     ctgaagctgg cgttgacctc ctacatggtg gcgctggcgg tgttcatccc ggtcagcggc       180
     tggatggccg acaggttcgg cgccaagaaa atcttccgcc ttgccatctc ggtcttcgtc       240
     atcggctcga tcttctgcgc aatttcgtcc aacctcgtcg aattcgtgtt tgcccgcttc       300
     ctgcagggca tgggcggcgc gatgatgacg ccggtcggcc gcctcgtgct ggtgcgcacg       360
     acgcagcgta gcgatcttgt ctcggccatg gcgctgctca ccatacccgc acttgtcggc       420
     ccgctcaccg gaccgccgct cggcggtttc atcaccacct atttcagctg gcactggatc       480
     ttcctgatca acgtgccagt cggcatcatc ggcatctcgc ttgcgacgat cttcctgccg       540
     gaggtggaag cgacggcgcc gccgcggctc gatttcaccg gtttcgtgct gacttcgcta       600
     tcggctgcgg gcgtcgtctt cggcctgtcg gtggtcagtc tgccggccct gcccccgatc       660
     atcggcgtca ccgccacctt gatcggcctc atctgcggcg tcctctacgt gcgccatgcc       720
     aagcgtcatc cggcgccgat cctcaatctc aacctgttca agaacccgac gtttcgggcc       780
     tccaccttgg gcggcatgct ctttcgcatt tgcgtcggcg ccatgccatt cctgacgccg       840
     ctgatgctgc agctcggctt cgggctgacg ccgttccaat ccggcctcat cacctttgca       900
     ggcgcgatcg gggcgatcac caccaagttc atggcgaagc gcgtcttcgc cgccgccggc       960
     ttccgcacaa cgcttctcgg cgccgccatg gtaacgaccc tggtgactgt cgtcaccggc      1020
     ctgttcacgc cgtcgacgcc gcatctcgtc atcatcggcg tgctgctgct cggcggcttc      1080
     tcccgctcct tcatgttcac cggggtgaat gcgcttgcct tcgccgacat cgatgatgcc      1140
     gaagctagcc aggcgacatc gatgagctcg gtgatgcagc aggtcagcct ggcgctcggt      1200
     gttgcggtcg ccgccgcgat cctggagagc tcgatctatt tccgcggcga agcgctgcag      1260
     gtggccgatt tccaccttgc cttctacatc atcgccggac tgacggtcat tgcgaccatt      1320
     cccttcatcc gaatggaccg caatgccggc gcactcgttt ccggccaccg cttgaagacg      1380
     atgacggccg caactgttga agccgaacag cacgcggtga aataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page