(data stored in ACNUC7421 zone)

EMBL: CP001622.PE47

CP001622.PE47        Location/Qualifiers
FT   CDS_pept        46496..48781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0048"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein NAD-binding; malic protein domain protein; KEGG:
FT                   rec:RHECIAT_CH0000430 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54359"
FT                   /db_xref="GOA:C6AYD5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD5"
FT                   /inference="protein motif:PRIAM:1.1.1.40"
FT                   /inference="protein motif:PRIAM:2.3.1.8"
FT                   /protein_id="ACS54359.1"
FT                   /translation="MPDIDKKDRPVTSVTDQEALDFHAMGRPGKLEINPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFA
FT                   PENVILCDTKGVIYQGRTEGMNQWKSAHAAKTDTRTLEEAMKGADVVFGLSQQGAFSAK
FT                   MIRSMAERPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVNALANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIESGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAAMSYANQQLGTAILLGREDLIRATAERAGIDLNRPGLEIVNARLSTRVEA
FT                   YIDYLYARLQRHGYLHRDAQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEELADIAEEAAGLARRMGYPPR
FT                   VALLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKPVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
     atgcccgata tcgataagaa ggaccggccg gtgacctcgg ttaccgacca ggaggcgctc        60
     gattttcacg caatgggccg gcccggcaag ctggagatca acccgaccaa gccgatggcg       120
     acgcagcgtg acctctcgct tgcctattcg ccgggcgttg ccgtgcccgt gaaggcgatc       180
     gccgccgatc cgcagaccgc ctatgattac acggcgcgcg gcaatatggt cgccgtcatt       240
     tccaacggca cggcaatcct cggcctcggc aatctcggcg cgctggcgtc caagcccgtc       300
     atggagggca aggcggtgct gttcaagcgc ttcgccgatg tcgattccat cgacctcgag       360
     atcgataccg aaaatgtcga cgagttcatc aactgcgtgc gcttcctcgg tccttccttc       420
     ggcggcatca acctcgagga tatcaaggca ccggattgtt tcgtcatcga aagccggctg       480
     cgcgagctga tggacattcc ggtgttccat gacgaccagc atggaacggc gatcatcgcc       540
     gccgccggcc tgatcaacgc gctggagctg accggccgcg acctgaagac gacgaagctc       600
     gtctgcaacg gcgcgggtgc tgcggcgatc gcctgcgtcg aactcatcaa ggcgatgggt       660
     tttgcgcccg agaacgtcat cctctgcgat accaagggtg tcatctacca gggccgcacc       720
     gagggcatga accaatggaa atcggcgcat gcggcaaaga ccgacacgcg cacgctggaa       780
     gaggcgatga aaggcgcgga cgtcgttttc ggcttgtcgc agcagggcgc gttttcggcc       840
     aagatgatcc gctcgatggc ggagcggccg atcatcttcg ccatggccaa tcccgatccc       900
     gagatcacgc cggaagaggt ggctcgcatc cgcgacgacg ccatcatggc gacgggccgt       960
     tcggactatc cgaaccaggt caacaacgtc ctcggctttc cctatatctt ccgcggcgct      1020
     ctcgacgtcc gtgcctcgac catcaacgat gcgatgaaga tcgccgccgt caatgcgctg      1080
     gcaaaccttg cccgcgagga cgtgcccgat gacgtggttg ccgcctatca gggcaaccgg      1140
     ccgcgtttcg gctcgcaata catcatcccc gttcccttcg atccgcgcct gatctcggcg      1200
     atcccggtcg cggtggcgca agccgcgatc gaaagcggcg tcgcccgcaa ggtcatcacc      1260
     gacatggccg gttatgcccg cgagctttcg gcgcgccgcg atccgatcgc ctcgacgctc      1320
     gccagcctct atgagcgcgt ccgccgccgt ccgaagcgca tcgtctttgc cgaggccgag      1380
     gaagaacagg tcctgcgtgc ggcgatgtcc tacgccaacc agcagctcgg caccgccatc      1440
     ctgctcggcc gcgaggacct gatccgggct acggccgaac gcgccggcat cgatctcaac      1500
     cggccgggcc tcgaaatcgt caatgcccgg ctttcgaccc gggtcgaggc ctatatcgac      1560
     tatctctatg cccggctgca gcggcacggt tatctccacc gcgacgccca gcggctgatc      1620
     cataacgacc gcaaccactt cgccgccacc atggtggcgc tcggcgatgc cgacggcatg      1680
     gtgacgggca ttacccgaaa ctattcgacg gcgctcgaag atgtgcgccg ctgcatcgac      1740
     gagaagccgg gccaccgcgt catcggcgtg tcgctggcgc tctgccgcgg ccgcacggtc      1800
     ttcgttgccg atacggcggt gcacgacatg ccgacggccg aagagcttgc cgatatcgcc      1860
     gaagaggccg cgggtctggc gcggcgcatg ggttatccgc cgcgtgtcgc cttgctggct      1920
     tattccacct tcggccatcc ctcgggcgaa cgctccgagc gggtgcgcga ggcggtgaag      1980
     atcctcgaca agcgccgcgt cgatttcgaa tatgacggcg agatggcggc cgatgtcgcc      2040
     ctgaaccgca aggtgatgga gcaatatccc ttttgccgcc tctccggccc ggccaacgtc      2100
     ctcgtcatgc cggccttcca ctcggcctcg atctcgacca agatgctgca ggagctcggc      2160
     ggctccacgg tgatcggccc gatcctcgtc ggcctcgaca agccggtgca aatcacctcg      2220
     atgggcgcca aggacagcga catcgtcaac atggcggcga tcgccgccta cggggcgggt      2280
     tcgtaa                                                                 2286
//

If you have problems or comments...

PBIL Back to PBIL home page