(data stored in ACNUC7421 zone)

EMBL: CP001622.PE470

CP001622.PE470       Location/Qualifiers
FT   CDS_pept        495862..496854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0476"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000878 putative beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54782"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G2"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS54782.1"
FT                   /translation="MTISSGIKRRTLFAAGLGLLGAPVILREKAEAAATGERNHMDGTL
FT                   LPEINQFKLGSYTFTVVRDGTSIVEKPYETFGTNQDPETVKGLLTANFLPADKFMNGYT
FT                   PALIDTGSDVILVDTGFGAAGRARGAGQLTEGLKAAGYSADDVTLVALTHLHGDHIGGL
FT                   MEDGAAAFKNARYVVGQAEYDFWSDKAREGTPAEGGHKAVLANVVPFAEKTTFIKEGDS
FT                   VAPGVTAVLAAGHSPGHMVFHVESEGKRLVLTGDTANHYILSLLRPDWEVRFDMDKAQA
FT                   AATRRKVFEMIASEKIAFLGYHMPFPAVGFVERQDGGYRFVPKSYQFDI"
     atgacaattt cgtcgggaat aaagcggcgc accctttttg ccgcaggcct tggcctgctg        60
     ggggcgccgg tcattttgcg agagaaggcc gaagcggccg caactggaga acgcaatcat       120
     atggatggaa cgcttttgcc cgagatcaat caattcaagc tcggttccta tacgttcacc       180
     gtcgtccgtg acggcaccag cattgtcgaa aagccctatg aaaccttcgg caccaatcag       240
     gaccccgaaa ccgtcaaggg attgctgacc gcaaacttcc tgccggccga caagttcatg       300
     aatggctata cgccggctct catcgatacc gggtcggatg tcatcctcgt cgataccggc       360
     ttcggcgctg ccggccgcgc acgtggcgcc ggtcaactga ccgaaggctt gaaggcggcg       420
     ggatattcgg ccgacgacgt cacgctggta gcgctgaccc atctgcacgg tgatcatatc       480
     ggcggcctga tggaagacgg cgcggctgcc ttcaagaatg ctcgctatgt cgtcggccag       540
     gcggaatatg atttctggtc ggacaaggca cgtgagggca cacctgccga gggcggccac       600
     aaggcggtgc tcgccaatgt cgtaccgttc gccgagaaga ctacttttat caaagaaggt       660
     gatagcgtcg cgcccggtgt gactgcggtg ctggcggccg gccactcgcc gggacatatg       720
     gtgttccacg tcgaatccga gggcaaacgc cttgtgctca ccggcgatac cgccaaccat       780
     tatatcctgt cgctgctgcg gccggattgg gaggtgcgct tcgacatgga caaggcgcag       840
     gctgccgcca cccgccgcaa ggtcttcgag atgattgcga gcgagaagat cgccttcctt       900
     ggctaccaca tgcccttccc ggcggtcggc ttcgtcgaaa ggcaggatgg cggttatcgc       960
     ttcgtgccga agagctatca gttcgacatc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page