(data stored in ACNUC7421 zone)

EMBL: CP001622.PE471

CP001622.PE471       Location/Qualifiers
FT   CDS_pept        497135..498619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0477"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: ret:RHE_CH00794 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; 2-nitropropane dioxygenase NPD;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54783"
FT                   /db_xref="GOA:C6B2G3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G3"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACS54783.1"
FT                   /translation="MARIIETATGADALTFDDVLLQPGHSEVMPGQTNISTRIARDFEL
FT                   NIPIISSAMDTVTESRLAIAMAQAGGLGVIHRNLTPIEQAEQVRQVKKFESGMVVNPVT
FT                   IGPDETLADALGLMKSYSISGIPVVEKSGRLVGILTNRDVRFATDQEQKIHELMTKDKL
FT                   VTVKENVDQQEAKRLLHSHRIEKLLVVDTEGRCVGLITVKDIEKSQLNPNASKDAQGRL
FT                   RAAAAISVGDDGFERAERLIEAGVDLLVVDTAHGHSQRVLDAVSRVKKLSNSVRIMAGN
FT                   VATYDGTRALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMSAVQAANDQDVPVI
FT                   ADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVYLYQGRSFKAYRGMGSVGAMA
FT                   RGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGVIHQLAGGLKAAMGYVGGKDLKDF
FT                   QERATFVRISGAGLRESHAHDVTITRESPNYPGAGL"
     atggcacgca tcattgaaac ggcaaccggc gcagatgcgc ttaccttcga cgacgtgctg        60
     ctgcagccgg gacattccga ggtcatgccc ggccagacga atatctctac ccgtatcgct       120
     cgggatttcg aactcaacat cccgatcatc tcatccgcca tggataccgt cactgagagc       180
     cgcctggcga tcgccatggc ccaggccggc ggcctcggcg tcatccatcg caacctgacg       240
     ccgatcgagc aggccgagca ggtccggcaa gtgaagaagt ttgaaagcgg catggtcgtc       300
     aatccggtga cgatcggccc ggatgaaaca cttgccgatg cgctcgggct catgaagtcc       360
     tacagcattt ccggcatccc tgtcgtggag aagtccggcc gcctcgtcgg gatcctgacc       420
     aaccgcgacg tccgtttcgc taccgatcag gaacagaaga tccatgagct gatgaccaag       480
     gacaaactgg tcaccgtcaa ggaaaacgtc gatcagcagg aggccaagcg cctgctgcat       540
     tcgcatcgca tcgagaagct gctggtggtc gataccgaag gccgttgcgt cggtctcatc       600
     accgtcaagg acatcgagaa gtcgcagctg aacccgaacg cttccaagga tgcgcagggc       660
     aggcttcgcg cggccgccgc catcagcgtc ggtgacgacg gcttcgagcg cgccgagcgt       720
     ctgatagagg ccggcgtcga ccttctggtc gtcgatacag cccatggcca ctcgcagcgc       780
     gtcctcgatg ccgtcagccg cgtcaagaag ctttccaact cggtgcgcat catggccggc       840
     aacgtcgcca cctatgacgg caccagggcg ctgatcgatg ccggcgcgga cgccgtcaag       900
     gtcggcatcg gtccgggttc gatctgcacg acgcgcatcg tcgccggcgt cggcgtgccg       960
     cagttggccg ccatcatgtc ggcggtgcag gccgcgaatg atcaggacgt gcccgtcatc      1020
     gccgatggcg gtatcaagtt ctccggcgat cttgccaagg cgatcgctgc cggcgcttcc      1080
     gccgtcatga tcggctcgct gcttgccggc accgatgaga gcccgggcga ggtctatctc      1140
     taccagggac gctccttcaa ggcctatcgc ggcatgggct ccgtcggcgc catggcccgc      1200
     ggctcggccg accgttactt ccaggccgag gtgcgcgaca cgctgaagct cgtgcctgag      1260
     ggcatcgaag gtcaggtgcc gtacaagggg ccggtttcgg gcgtcatcca tcagctcgcc      1320
     ggcggcctca aggcggccat gggttatgtc ggcggcaagg atctcaagga tttccaggag      1380
     cgggccacgt tcgtgcgcat ctccggtgcc ggtcttcgcg aaagccacgc ccatgacgtg      1440
     acgatcaccc gcgagagccc gaactatccg ggcgccggcc tctga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page