(data stored in ACNUC7421 zone)

EMBL: CP001622.PE472

CP001622.PE472       Location/Qualifiers
FT   CDS_pept        498622..499176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54784"
FT                   /db_xref="GOA:C6B2G4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00795"
FT                   /protein_id="ACS54784.1"
FT                   /translation="MKAGSGIPLWIVALLAALCLAVLAWTTFGFVVPFKHETGQAVLDT
FT                   YFAGYDESAVFHMQKLLDENETATRLLRAMYFGPELIFPALLTALLFLAFLKLGPGGAW
FT                   FGRSAHPLVGKAIYLLPFIYGIADYGENISSLIAFGNGASAGLATQLLPWMTRLKFASL
FT                   AICFILIARLAVMRWLSSRPD"
     atgaaggcgg gcagcgggat tcctctctgg atcgtcgcgc tgctcgcagc cctctgcctt        60
     gccgtgctcg cctggacgac cttcggcttc gtcgtcccgt tcaagcatga aactggccag       120
     gcggtgctcg atacctattt cgccggttac gacgagtcgg cggtcttcca catgcagaag       180
     ctgcttgatg agaacgagac ggcgaccagg ctgctgcgcg ccatgtattt cgggccggag       240
     ctgatctttc cggccttgct gacggcgctg ctgttcctcg ccttcctcaa actcggtccc       300
     ggcggtgcat ggttcggccg atcggcgcat ccgctcgttg gcaaggcgat ctacctgctg       360
     ccgttcatct acggcatcgc cgactacggc gagaacatct cgagcctcat cgccttcggc       420
     aacggtgcgt ctgcaggtct tgcaacgcag ctgctgccgt ggatgacacg gctgaaattc       480
     gcaagccttg ccatctgctt catcctcatc gcccggctcg ccgtcatgcg ctggctctcg       540
     tcgcgcccgg actga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page