(data stored in ACNUC7421 zone)

EMBL: CP001622.PE473

CP001622.PE473       Location/Qualifiers
FT   CDS_pept        499341..499757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0479"
FT                   /product="protein of unknown function DUF1123"
FT                   /note="PFAM: protein of unknown function DUF1123; KEGG:
FT                   rec:RHECIAT_CH0000883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54785"
FT                   /db_xref="GOA:C6B2G5"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G5"
FT                   /inference="protein motif:PFAM:PF06561"
FT                   /protein_id="ACS54785.1"
FT                   /translation="MTGYQIFWPLLAHVALVYGLYALLGLRRAKMVRAGSIVKSDYREN
FT                   RGEPAESLVVKNCLANQFELPVLFYACCILLYITEADNLVALGLAWAFVALRYAHAAIH
FT                   VTSNDLRYRSPIFAAGYLVLAAMWIWLAAWMLMS"
     atgaccggct atcaaatctt ctggccactg ctcgcccatg tggccctggt ctatggtctt        60
     tatgcgcttc ttgggcttcg gcgcgcaaaa atggtccgcg ccggcagcat cgtgaaatcg       120
     gattatcgcg aaaaccgcgg cgagccggcc gaaagccttg tcgtcaagaa ctgcctcgcc       180
     aaccagttcg aactgccggt gctcttctac gcctgctgca ttcttctcta tatcaccgag       240
     gcagacaatc tcgtcgccct cggcctcgcc tgggccttcg tcgccctgcg ttacgcccat       300
     gccgccatcc acgtcaccag caacgacctg cgttatcgca gcccgatctt cgccgccggt       360
     tacctggtgc ttgccgccat gtggatctgg cttgccgcat ggatgctgat gagctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page