(data stored in ACNUC7421 zone)

EMBL: CP001622.PE474

CP001622.PE474       Location/Qualifiers
FT   CDS_pept        500049..503138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0480"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bpa:BPP0822 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54786"
FT                   /db_xref="GOA:C6B2G6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G6"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACS54786.1"
FT                   /translation="MGERISGAAIQGMVMLRLTGLASTAALVLAVGPGWAQVITGNDTE
FT                   IVDGNDPGGTGAGTQPSPWTINTNLIVGDQNGDDAALVIRNGGIVSNDIGVLGVDPGAA
FT                   GTVTVTGTGSAWTNSDDLYVGHRGVGVLNIEDGGVVDNIFGRIGYFSGASGTVTVTGTG
FT                   STWTNAQDLYIGDSGTGTLTISNGGTVSSTAGLISNDTTAIGEVIVTGTNSIWSNSSYI
FT                   SVGEAGAGTLTISNGGSVTASEGYVGYSSNGNGVVSVTDTGSSWINSGALFVGEFGSGS
FT                   MSVENGGTVSASEVIIADDSGATGTVRIAGSAANGRGVLETGYIERGGGDADLVFDGGI
FT                   LSATGNEANFLRGFNAGEVTIDAGGAFIDTNGFAVGIATDLQGAGGLTKKGSGTLTLSG
FT                   TSSFTGVTTVEAGTLQAGSAGAFVQNGAYAVNGGIFDLGGFDLTMAQLSGSGGEIVIGS
FT                   AELTLDQANNTTYGGILSGSGDFTMLGSGTLRLTGNSSGFAGTTTVSDGRLIVNGSLGG
FT                   ILMMTGGTLAGSGHIGTVTAGAGVTIAPGNSIGTLTIGGNLTLDPSSTYEVEVDPAGTA
FT                   SDLISVTGTAFLNGASVTHVGMNGDYQPFSTYTILTAAGGINGTFGAVTSDYAFLAAEL
FT                   SYDLNNVYLEIERNNVRFSDMARTRNQMAAAEAAENLGTGNDIYDAIVTLPDDEPLIQA
FT                   SYDALSGEIHGSIKTALITQSLVVRQAANERLRSAFSDASAGVIPIQAFWPGGPELIAA
FT                   NPSDAPVFWSTAFGGASETRTDGNAATLNHQTGGLLAGVDAMFDDVRLGLMAGYSNSQF
FT                   DPRHRSSSGSSDDYHLGLYAGTQWGGLAFRTGLAHTWHEIETNRSVAIGSFEDRLEASY
FT                   NAGTLQAFAELGYRFDTAAATFEPFVNLAHIGIRTAGFTEGGGAAALDSSSRMTNTTIT
FT                   TLGLHAEMEVRLGETNATLRGMSGWRHAAGDIVPVSTHAFAGGDAFTVAGVPVAENAFV
FT                   LDAGLDFDLTESAILGIAYSGQIADNAQQHGAKATLSVKF"
     atgggcgaaa ggatatctgg agcggcaatc caagggatgg tcatgctgcg acttacggga        60
     ttggcgagca ctgcggcgct ggtgctggct gtagggccgg gatgggcgca ggtcatcacc       120
     ggcaacgaca cggagatcgt cgatggcaac gacccgggcg gtaccggcgc gggcacgcaa       180
     ccgagtccat ggacaatcaa taccaacctc atcgtgggcg atcagaatgg tgacgatgca       240
     gcccttgtca tccggaatgg cggcatagtc agcaatgaca tcggcgtgct cggtgtcgat       300
     cccggcgctg caggaacggt aacggttacg gggacgggct cggcctggac caattccgac       360
     gacctctacg tcggccatcg gggtgtcggc gtgctcaata tcgaagatgg cggcgttgtc       420
     gacaatatat tcggccgtat cggctatttc tctggcgcca gcggcacggt gacggtcacc       480
     ggcaccggct cgacctggac caacgcccag gatctttata tcggcgacag cggcaccggc       540
     actctgacca tttcgaatgg cggcacggtc agcagcactg ccgggcttat cagcaacgac       600
     acgactgcca tcggcgaggt catcgtcaca ggcacgaact cgatctggag caattccagc       660
     tatatctcgg tcggcgaggc gggagcggga acgctgacca tttcgaatgg cggctcggtc       720
     actgcgagtg aaggttatgt cggctatagt tcgaacggca acggcgtggt gagcgtgacc       780
     gatacggggt cgagctggat caattccggc gcgctgttcg tgggcgaatt cggttcaggc       840
     agtatgagcg tcgagaatgg cggcacggtt tcggcttccg aggttatcat cgccgacgat       900
     tcgggcgcca cgggaactgt gcggatcgcc ggaagcgccg caaacgggcg cggcgtcctg       960
     gagaccggtt atatcgagag aggcggtggt gacgcggacc tcgttttcga tggcggtatt      1020
     ctcagcgcaa cgggcaacga ggcgaatttc ctgcgcggtt tcaacgccgg cgaggtaacg      1080
     attgatgctg gcggcgcctt tatcgatacg aacggctttg ccgtcggcat tgccacggat      1140
     ttgcaaggcg ccggtggctt gaccaaaaag ggcagcggca cactgacgct ttcgggcacc      1200
     agcagtttta ccggtgtgac gacggtcgag gccggcacgt tgcaggcggg cagcgccggt      1260
     gccttcgtgc agaatggcgc ctatgcggtc aatggcggca tattcgatct cggcggcttc      1320
     gacctgacga tggcgcagct ttcgggaagc ggcggcgaga tcgtcatcgg cagcgccgaa      1380
     ctcacgctcg atcaggcgaa caacaccacc tatggcggca tactctccgg cagcggcgac      1440
     ttcacgatgc tgggcagcgg caccttgcgc ctgaccggca acagttcggg ctttgccggc      1500
     acgaccacgg tttcggacgg acgcctgatc gtcaatggca gccttggcgg catcttgatg      1560
     atgacgggcg gcacgctggc cgggtcgggt catatcggta cggtgaccgc cggcgcaggc      1620
     gtcaccatcg cgccgggcaa ctccatcggg acattgacca tcggcggcaa cctcaccctc      1680
     gatcccagtt ccacctatga ggtcgaggtc gatccggctg gcactgccag cgatttgatc      1740
     tcggtcacgg ggaccgcgtt cctcaacggc gccagcgtta cccatgttgg gatgaatggc      1800
     gactaccagc ctttctccac ctatacgatc cttaccgccg ctggcgggat caacggaaca      1860
     ttcggcgccg tcacctccga ttatgccttc ctggcggcgg agctctccta tgatctgaac      1920
     aacgtctatc tggagatcga acgcaacaac gtgcgtttca gcgacatggc acggacgcgc      1980
     aaccagatgg ccgcggcaga ggctgcagag aatctcggaa ctggcaacga tatctacgac      2040
     gccatcgtca cattgcccga tgacgagccg ctgattcagg ccagttacga cgcgctttcc      2100
     ggtgaaatcc atggctcgat caaaacggcg ctgattacgc aaagcctcgt tgtccgccag      2160
     gccgccaacg aacgtctgcg ttccgcgttt agcgacgcca gtgctggcgt aatcccgata      2220
     caggctttct ggccgggcgg tccggaactc atcgctgcca atccttcgga cgcgccggtt      2280
     ttctggagca cggcttttgg cggcgcaagc gagacacgca cggacggcaa tgccgccacc      2340
     ctcaaccacc agaccggcgg gcttctcgct ggcgtcgacg ccatgttcga tgacgtcagg      2400
     ctcggcctga tggccggtta cagcaactcc caattcgacc cgcggcaccg aagctcatcg      2460
     ggatcgagcg acgattatca cctcggcctt tacgcgggca cgcaatgggg cggtctcgcc      2520
     ttccgcaccg gtctcgctca tacgtggcac gagatcgaga ccaaccgcag cgtcgctatt      2580
     ggaagcttcg aggacaggct ggaagcaagc tataatgccg gcacgctgca ggcatttgcg      2640
     gagctgggct atcggtttga tacggcggcg gccactttcg agcctttcgt caatctcgcc      2700
     catatcggca ttcgaacggc gggtttcacc gaagggggcg gggcggcagc gctcgacagc      2760
     tccagccgca tgaccaacac caccatcacc acgcttggcc tgcatgccga aatggaggtt      2820
     cgcttgggcg agacgaacgc caccctgcgc ggcatgtcag gctggcggca tgccgccggc      2880
     gacatcgttc cggtgtcgac gcatgctttt gccggaggcg acgcgttcac cgtcgccgga      2940
     gtgccggtgg cagagaacgc cttcgttctt gacgccgggc tcgacttcga cctcaccgaa      3000
     agcgccatcc tcggcatcgc ctattccggc cagattgccg acaacgcgca gcagcatggg      3060
     gccaaagcga cgctgtcggt gaaattctaa                                       3090
//

If you have problems or comments...

PBIL Back to PBIL home page