(data stored in ACNUC7421 zone)

EMBL: CP001622.PE475

CP001622.PE475       Location/Qualifiers
FT   CDS_pept        503275..503994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0481"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000884 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54787"
FT                   /db_xref="GOA:C6B2G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54787.1"
FT                   /translation="MRVFPFTADEDLHVMPSAANKKNGNDMGAESMDRIGLRRKPKQER
FT                   SIQRLDLILAAAAKIIAEKGVSAMRMTELAAAAKVPIGSVYQYFPEKAAIVKALFDQHA
FT                   SAIQTKMAAMFADVRSLDQALDVVCATIDWYYDSYHDDPVYLGVWMGTETDQDLLQLNI
FT                   EHSGHVAGIFRDAVRQLAPDLCDEEMYARTYLFSHLIGAVIRLAAVSEEALARRMLDEW
FT                   KRVIRASLFTVTVPAAA"
     atgcgagtgt ttccctttac ggccgatgaa gacctgcatg tcatgccttc cgccgcgaac        60
     aaaaagaatg ggaacgacat gggcgcggaa agcatggatc ggatcggctt gcgcaggaag       120
     ccgaagcagg agcgcagcat ccagaggctg gacctcattc tcgccgccgc cgccaagatc       180
     atcgccgaaa agggcgtcag cgccatgcgg atgacggagc tcgccgctgc agccaaggtg       240
     ccgatcggtt cggtctacca gtatttcccg gagaaggcgg cgatcgtcaa agccctgttc       300
     gaccagcatg cctcggcgat ccagacgaag atggcggcga tgtttgccga cgtacggtca       360
     ctcgaccagg cgctggacgt ggtctgcgcc accatcgact ggtattacga ttcctaccac       420
     gacgatcccg tctatctcgg tgtctggatg ggaacggaga ccgatcagga tctgttgcag       480
     ctgaatattg agcatagcgg tcacgtcgcc ggcatcttcc gtgacgccgt gcgtcagctg       540
     gcccctgacc tttgcgacga agaaatgtat gcgcgcactt acctgttcag ccacctgatc       600
     ggcgccgtga tccgacttgc cgccgtcagc gaggaggcct tggcacggcg tatgctcgat       660
     gagtggaagc gcgtcatccg cgcctctctt ttcaccgtga ccgtgccggc tgctgcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page