(data stored in ACNUC7421 zone)

EMBL: CP001622.PE476

CP001622.PE476       Location/Qualifiers
FT   CDS_pept        complement(504001..504969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0482"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00800 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54788"
FT                   /db_xref="GOA:C6B2G8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54788.1"
FT                   /translation="MGDNMSAPLDLDQLQTFIAIVDSGSFTKAADRVYKTQSAVSMQMR
FT                   RLEERIGKQLFIKDGRGNRLTVEGEKLLNYARRIIRLNNEAIAAFDDNRLEGTLRIGTP
FT                   DDYADRYMPEIIGRFAKTHPNVELYIVCEPSVDLAERMHKGELDIALVTHNPRERMSDV
FT                   VRTEPLCWVGSANHPIRDDAPVPLAVGRRDCQWRQLACSALDAVGREHQILFTSWSCTV
FT                   VAAAVLAGMAVSVMPESALRTGMKVLSQADGFPALPPVQIGIMKRPGVSLSLMNAITAH
FT                   ITACLDNITPTVVDDSLEADVKSAQARLYPRLKAANMVPSW"
     atgggtgaca acatgtccgc gcctcttgat ctcgaccaat tgcagacttt catcgccatc        60
     gtcgattccg gcagcttcac caaggccgcc gacagggtct acaagaccca atcggccgtc       120
     tccatgcaga tgcgccgtct cgaggaacgc atcggcaagc agctgttcat caaggacggg       180
     cggggaaacc ggctgacggt cgagggcgaa aagctgctca actatgcgcg gcggatcatc       240
     cgcctcaaca atgaggctat cgccgccttc gacgacaaca ggctggaggg gacgctgcgc       300
     atcggcacgc ccgatgatta tgccgaccgc tacatgcccg aaatcatcgg ccgcttcgcc       360
     aagacgcacc cgaatgtcga gctctatatc gtctgcgagc cctcggtgga tcttgccgaa       420
     cgcatgcata agggcgagct cgacatcgcg ctcgtcaccc ataatccgcg ggagcgcatg       480
     tccgatgtgg tgagaaccga gccgctctgc tgggtgggct cggccaacca tccgatccgc       540
     gacgacgcgc cggtaccgct tgccgtcggt cggcgtgact gccagtggcg ccagctcgcc       600
     tgctcggcgc tcgatgccgt gggacgcgag caccagatcc tgtttaccag ctggtcctgc       660
     accgtcgttg ccgccgccgt gctggccggc atggcggttt cggtgatgcc ggaatcggcg       720
     ctgcggacgg gcatgaaggt gctgagccag gcggacggtt ttccagcgct gccgccggtg       780
     cagatcggca tcatgaagcg gccgggcgtt tcgctttcgc tgatgaacgc gatcaccgcg       840
     catatcaccg cctgcctcga caatatcacg cccactgtcg tcgacgacag cctggaggcg       900
     gacgttaaat ccgcccaggc gcgcctttat ccgcggttga aggcggccaa tatggtgcca       960
     agctggtaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page