(data stored in ACNUC7421 zone)

EMBL: CP001622.PE477

CP001622.PE477       Location/Qualifiers
FT   CDS_pept        505173..505472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0483"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   ret:RHE_CH00801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54789"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G9"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACS54789.1"
FT                   /translation="MRMTDRTIELDCGKLTPTFPQRLAAGLAPLTSLFRGFRNRMEINT
FT                   LHDLSDAQLRDIGLNRADLTSAFLASTFFEDPSEHLTRSARNRWRLSLFRSYEQ"
     atgcggatga cagacagaac aatagaactc gactgcggca agctcacccc gacgtttccc        60
     cagcgtctgg cagcaggcct cgcaccgttg acctccctct ttcgcgggtt ccgcaatcgc       120
     atggagatca acacgctgca cgatctgagc gacgctcagc tgagggatat cggccttaac       180
     agagccgacc tgacctccgc gttcctggca tcgacctttt tcgaggaccc gtcggaacat       240
     ctgacgcgct cggcgcgcaa tcgctggcgc ctgtccctct tccgctccta cgaacagtag       300
//

If you have problems or comments...

PBIL Back to PBIL home page