(data stored in ACNUC7421 zone)

EMBL: CP001622.PE478

CP001622.PE478       Location/Qualifiers
FT   CDS_pept        complement(505632..506498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54790"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000887"
FT                   /protein_id="ACS54790.1"
FT                   /translation="MLPLFDMMMQAQNGAAMEAIARQFNLAQEQATKAMAALMPAFSAG
FT                   LKRSTSNPYDFVGLMQAVSSGNYARYFEDMNRAFTPEGISDGNNILAQLFGSKEVSRAV
FT                   AAQAAQMTGIGQDIYKRMLPVLADTLMGGLFKQTTGQMASPVNPFVNTAMGETMQKWLE
FT                   STGFAPKPKTTPDPSIFDNPFTQAMQLMFSVPKPEATSQPNPFLDNPFAKAFQEMMGGL
FT                   GQQPAAQTKTKTPEAPKEEAKLNADSYTEMLNAMFDSGLEVQKNYQRNLEAIFETYRPK
FT                   PSSDKSE"
     atgctgccac tcttcgacat gatgatgcag gcgcagaacg gcgcggcgat ggaggcgatc        60
     gcccggcagt tcaacctcgc gcaggaacaa gcgacgaagg caatggcggc gctgatgccg       120
     gccttttccg ccgggctgaa gcgcagcacc agcaatccct atgatttcgt cgggctgatg       180
     caggcggtct cctccggcaa ctatgcgcga tatttcgagg atatgaaccg ggcgttcacg       240
     ccagagggta tttccgacgg caacaacatc cttgcccagc tcttcggctc gaaggaggtt       300
     tcgcgcgcgg tcgccgccca ggcggcacag atgaccggta tcggccagga tatttataag       360
     cggatgctgc cggtgctggc cgatacgctg atgggcgggc tctttaaaca gacgaccggc       420
     cagatggcct cgccggtcaa ccccttcgtc aacacggcga tgggcgagac catgcagaaa       480
     tggctggaaa gcaccggctt tgcgccgaag ccgaagacga ccccggaccc cagcatcttc       540
     gacaatccct tcacccaggc gatgcagctg atgttttcgg taccgaagcc ggaagcgaca       600
     tctcagccga accccttcct cgacaatccc ttcgccaagg ccttccagga gatgatgggc       660
     gggctcggcc agcagccggc ggcgcagact aagaccaaga cgccggaggc gccgaaggaa       720
     gaggcgaagc tcaatgccga cagctatacc gagatgctga acgccatgtt cgacagcgga       780
     ctggaagtgc agaagaacta ccagaggaac ctggaagcga tcttcgaaac ctatcggcct       840
     aagccctcct cggacaagag tgaatag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page