(data stored in ACNUC7421 zone)

EMBL: CP001622.PE479

CP001622.PE479       Location/Qualifiers
FT   CDS_pept        complement(506844..508217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0485"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="KEGG: ret:RHE_CH00803 glutamate-cysteine ligase
FT                   protein; TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54791"
FT                   /db_xref="GOA:C6B2H1"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H1"
FT                   /inference="protein motif:TFAM:TIGR01436"
FT                   /protein_id="ACS54791.1"
FT                   /translation="MARDTTDQTPLSSVQDLTDYIAAGNKPREHFRIGTEHEKFAFFRA
FT                   DNSPVPYFGDASISALLTGLQKKSGWEPITDGGNIIGLAEQHGMGAISIEPGGQFELSG
FT                   APLETIHETCKESNQHLATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRY
FT                   MPKVGTQGLDMMYRTCTIQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPN
FT                   GLLSWRGDIWRDVDNRRAGLLDFSFRDDFGFRDYAEWALDAPMYFIVREGRYHDCTHVT
FT                   FRQFMNGALKGEVADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDAALDAADELTKDWTFAEISALRNAVPAEGLKAQFRGHPLFDMAREVVGISR
FT                   AGLKARGKLNREGQDETIFLAPLDEVLAKKATLAEDLLSLYHGRWHGSVEPVFEDYQY"
     atggcccgcg acactaccga ccagacaccg ctctcttcgg tccaggatct gaccgattat        60
     atcgccgcgg gcaacaagcc gcgggagcac ttccggatcg gcaccgaaca cgagaaattc       120
     gccttcttcc gcgccgacaa cagcccggtt ccctatttcg gcgatgccag catttcggcc       180
     ctcttgaccg gcctgcagaa gaaaagcggc tgggagccga tcaccgacgg cggcaacatc       240
     atcggccttg ccgagcagca tggcatgggc gcgatctcga tcgagcccgg cggccagttc       300
     gaactctccg gtgcaccgct ggagacgatc cacgagacct gcaaggaatc gaaccagcat       360
     ctggcgacgc tgcgcgaaat cgccgagccg atgggcatcc gcttcctcgg tatcggcggc       420
     agtccgaaat ggacctacgc ggaaacgccg cagatgccga aatcacgcta cgagatcatg       480
     acccgctata tgccgaaggt cggtacccag ggtctcgaca tgatgtaccg cacctgcacg       540
     atccaggtga acctcgattt ttcctcggaa gccgacatgc gcaagaaaat gcgcgtttcg       600
     atgaagctgc aatcgctggc gaccgcgctt ttcgcatcct cgcccttcac cgagggcaag       660
     ccgaacgggc tgctctcctg gcgcggtgac atctggcgcg atgtcgacaa tcggcgcgcc       720
     ggcctgctcg atttcagctt ccgcgacgat ttcggcttcc gcgactatgc cgaatgggcc       780
     ctcgacgcgc cgatgtattt catcgtccgc gaaggccgct atcacgactg cacccatgtc       840
     accttccgcc agttcatgaa cggcgcattg aagggcgagg tcgccgatcc ggcgccgacg       900
     atgggggact ggacgaacca tctttcgaca cttttccccg acgtgcggct gaagcgtttc       960
     ctcgaaatgc gcggcgccga cggcggcccg tggcggcgca tctgtgcgct gccggccttc      1020
     tgggtcggcc tgctctacga tgatgcagca ctcgatgctg ccgacgagtt gacgaaggat      1080
     tggacctttg ccgagatcag cgccctgcgc aatgcggttc ccgccgaagg gttgaaggcg      1140
     caattccgcg ggcacccgct cttcgacatg gcgcgcgaag tggtcggcat atcaagggcc      1200
     ggtctcaagg cgcgcggcaa gctcaaccgg gaaggccagg acgagacgat cttcctggcg      1260
     ccgctcgacg aggtgctcgc caagaaggcg acgctcgccg aggatttgct gtcgctctat      1320
     cacggccgct ggcacggctc cgtggagccg gtctttgagg actatcagta ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page