(data stored in ACNUC7421 zone)

EMBL: CP001622.PE48

CP001622.PE48        Location/Qualifiers
FT   CDS_pept        49014..50003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0049"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: rec:RHECIAT_CH0000431 putative
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54360"
FT                   /db_xref="GOA:C6AYD6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54360.1"
FT                   /translation="MPENASANFTPRFQGATFDDMVGALTKGFGSFDAWRDGRDKPLDW
FT                   KVGFWGDESLSLVSNQDSGGWGARTAHGTPETLAIIVPRTGALDVTLGRSVIEGTPGRL
FT                   LLANNLEPERISVRAAPHRSDTLSLSWTIIAQTVASVLETPLIGAMDLAPVIDLSTAAG
FT                   RLIGSLAQTIIIGMRNNGPLLASPIAMLNLTQAFADLLVRSVPHRLSHLLDRKIHLIAP
FT                   RHVRRAIEFMHANIAEPLTMQSVAEAAGISIRALESGFRAFKGTTPAAYLRTIRLQAVR
FT                   EDLRDPSNRQPLRDICLKWGFFHFGRFAATYRAAYGENPSDTRRRSDH"
     atgccagaaa atgcatccgc caatttcacc ccccgatttc agggggcaac tttcgacgat        60
     atggtcgggg ctctgaccaa ggggtttggt tcgttcgacg catggcgcga tggtcgagac       120
     aaaccgctcg actggaaggt cgggttttgg ggtgatgaaa gcttgtcgct ggtcagcaac       180
     caggattccg gcggctgggg tgcaagaacg gcccatggaa cgccggaaac tctggcaatc       240
     atcgttccac gcactggtgc tctcgatgta acgcttggtc ggtctgtgat cgaagggaca       300
     cctgggcggc tgctgttggc gaacaatctt gagccggaac ggatttccgt gcgggcagcg       360
     ccgcaccggt cagacacact gagtctgagc tggacaatca tcgctcagac cgttgcctcc       420
     gtattggaga cccccctgat cggggcaatg gacttggcac cggtcattga tctttccacg       480
     gcggcgggcc ggttgatcgg cagtctcgcc caaacgatca tcatcggcat gcgcaacaac       540
     gggccgctcc ttgcctcgcc aatcgccatg ttgaacctga cccaggcgtt tgccgatctg       600
     ctggtgcgct cggttcctca tcggctctcg catcttctcg acaggaaaat ccatctgatc       660
     gcaccccggc atgtccgtcg ggcaattgaa ttcatgcatg caaacatcgc agagccgttg       720
     acgatgcaga gtgtcgcgga ggcggcaggc atttccattc gcgctcttga aagcggtttt       780
     cgtgccttca agggaaccac accggctgcc tacctcagga cgatccgctt gcaagcggtc       840
     cgggaggatc tgcgcgatcc ttcaaaccgg cagccgttgc gggacatctg cttgaagtgg       900
     ggattctttc actttggccg ctttgcggca acctatcggg cggcgtatgg agagaacccg       960
     tcggacacca gaaggcgatc cgatcactag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page