(data stored in ACNUC7421 zone)

EMBL: CP001622.PE480

CP001622.PE480       Location/Qualifiers
FT   CDS_pept        complement(508365..509102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0486"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   rec:RHECIAT_CH0000889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54792"
FT                   /db_xref="GOA:C6B2H2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H2"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACS54792.1"
FT                   /translation="MRANFRMQRLFVDAPLTRGAGVEANADQFNYLANVLRMEDGGEIL
FT                   LFNGRDGEWKATLTFPTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVE
FT                   MGAGLLQPVMTQHVQGKVTNLDKLRANVIEAAEQCGILGIPDVAEPVRLLDLLDRWPSE
FT                   RRIIYCDEGDAGQNPLPVLSAIRERHLALLVGPEGGFSEEERARLRSLDFVTAIPLGPR
FT                   ILRADTAAVAALAVVQAAIGDWN"
     atgcgcgcca atttccgcat gcaacggctt ttcgtcgatg cgccgctcac gcgcggtgcc        60
     ggcgtggagg cgaatgccga tcagttcaac tatctcgcca atgtgctgcg gatggaggac       120
     ggtggggaga tcctgctctt caacggccgc gacggcgagt ggaaggcaac ccttaccttc       180
     cccacgcgca aacgcatcct tttgacggca accgaagaga cgcggccgca gccgcagcct       240
     tgcgacctgc attatctctt tgcgccgctc aaggtcggcc gcatggacta tctcgtgcag       300
     aaggcggtcg aaatgggagc cggcctgctg cagccggtca tgacccagca cgttcagggc       360
     aaggtcacca atctcgacaa gctgcgcgcc aatgtcatcg aggcggcgga gcaatgcggc       420
     attctcggca tccccgacgt ggccgagccg gtgaggcttc tcgacctgct cgaccgctgg       480
     ccgagcgagc gccgcatcat ctattgcgac gagggcgatg ccgggcagaa cccgctgccg       540
     gtgctctcgg cgatcaggga aagacatctc gctctgctcg tcgggccgga aggcggcttt       600
     tcggaagaag agcgggcgcg gcttcgaagc ctcgatttcg tcacggccat cccactcgga       660
     ccgcgcatcc tgcgggccga tacggcagcc gttgctgcct tggcggtggt ccaggcggcg       720
     atcggcgact ggaactaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page