(data stored in ACNUC7421 zone)

EMBL: CP001622.PE481

CP001622.PE481       Location/Qualifiers
FT   CDS_pept        complement(509201..510700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0487"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: ret:RHE_CH00805
FT                   phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54793"
FT                   /db_xref="GOA:C6B2H3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H3"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACS54793.1"
FT                   /translation="MPPRPAVLTKRTLDKDLDKITHAEDVAKHVLRRLVAPGLGLIFVG
FT                   LAMLFAGVYVFDRPGAMLVIAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALVI
FT                   AAIFEVLGATIAGGEVVKTISSNIVDAVQVPPALLGWIMMAALMAAALWINLATWMNAP
FT                   VSTTHAIVGAVIGAGISAVGPEPVNWQVMLEITSSWITSPLIGGLIAAGLLYLVKTLII
FT                   YRDDKVAAAQRWVPVLVAVMAGGFMAYMVLQLSPPGRFPPLTVLLIGIGIGLVSWLAAR
FT                   PLVLAQARELENRNSSLRTLFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSVGIGG
FT                   GGGIGHPPLWVMLIGALGISVGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIV
FT                   ASWLGLPVSTTHIAVGAVFGVGFFREWYTRHSKRRIAYIRRKAESFDIDEPEEPNIHET
FT                   RRRYLVRRSHFMTIVAAWIVTVPVSAALAAMIYWVMFALFV"
     atgccgccac gtcccgcagt cctcacgaaa cgcacgctcg acaaggacct cgacaagatc        60
     acccatgccg aggacgtggc gaagcatgtt ttgcggcggc tggtggcgcc tggtctcggg       120
     ctgatcttcg tcggtctggc catgctcttt gccggcgtct atgtattcga ccggccggga       180
     gcgatgctcg tcatcgcggc cgccgccctt gccggctata tggcgatgaa catcggcgcc       240
     aacgacgtga ccaacaatgt cggtgccgcc gtcggggcgc gcgccatgac gatgggccag       300
     gcattggtca tcgctgcgat tttcgaagtt cttggcgcca cgatcgccgg cggcgaggtc       360
     gtcaagacga tttcctcaaa catcgtcgac gccgtccagg taccgccggc gctgctcggc       420
     tggatcatga tggcggcgct gatggcggcg gctctctgga tcaacctcgc aacctggatg       480
     aacgcgccgg tttccaccac ccatgctatc gtcggcgcgg tgatcggcgc cggcatctca       540
     gccgtcgggc cggaaccggt gaactggcag gtaatgctgg agatcacctc gagctggatc       600
     acctccccgc tgatcggcgg gctgatcgcc gccgggctgc tttatctcgt caagacgctc       660
     attatctatc gcgatgacaa ggtcgcggcg gcccaacgct gggtgccggt gctggtcgcg       720
     gtgatggccg gcggcttcat ggcctatatg gtgctgcagc tgtcgccccc gggcaggttc       780
     ccgccgctga ccgtcctcct catcggaatc ggcatcgggc tggtgagctg gcttgccgcc       840
     cggccactcg ttctcgccca agcgcgggag ctcgaaaacc gcaacagctc gctgcgaacg       900
     ctgttccggc tgccgctgat cggctctgcg gcgctgctgt ccttcgcgca tggcgcaaac       960
     gacgtttcga acgcggtcgg gccgctgtcg gcgattgtcc attcggtcgg catcggcggc      1020
     ggcggcggca tcgggcatcc gccgctctgg gtgatgctga tcggcgccct aggcatctcc      1080
     gtcggtctgc tgctcttcgg gccgcgcctg atccgcctcg tcggcgagga aattaccaag      1140
     ctcaatccga tgcgggccta ttgcgtggcg ctgtcgacag cttttaccgt catcgtcgcc      1200
     tcctggctcg gtctgccggt cagcaccaca catatcgccg tcggcgccgt cttcggcgtc      1260
     ggattcttcc gcgaatggta tacgcgccat tcgaagcgtc gcatcgccta tatcaggcgc      1320
     aaggccgaga gctttgatat cgacgagccg gaagagccga atatccacga gacccggcgg      1380
     cgctatctcg tgcgccgttc gcatttcatg acgatcgtcg ccgcctggat cgtcaccgtg      1440
     ccggtttcgg cagcgcttgc ggcaatgatt tattgggtta tgttcgcgct cttcgtctaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page