(data stored in ACNUC7421 zone)

EMBL: CP001622.PE482

CP001622.PE482       Location/Qualifiers
FT   CDS_pept        complement(510763..511293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0488"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000891
FT                   putative NTP pyrophosphohydrolase protein, MuT/NUDIX
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54794"
FT                   /db_xref="GOA:C6B2H4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54794.1"
FT                   /translation="MTLFARLASDVQLMFRRPPRQQYGALCYRVKKKSGEVEVLLMTSR
FT                   DTGRWVIPKGWPMTRKCAHEVAMQEAFEEAGVRGAVETETLGAYTYSKALRDGVQVICK
FT                   VQVYALEVTDMAKNFKEKGERRIEWVSFDEAAARVREPELRHLFLAFKQKMTDRLSAKA
FT                   AKQIPDVKQIPAE"
     ttgactcttt tcgcccgact ggcttccgat gtgcaactga tgttccggcg tccgccgcga        60
     cagcaatatg gtgcgctctg ctatcgggta aagaagaaga gcggtgaggt cgaggtgctg       120
     ttgatgacga gccgcgatac cggccgctgg gtcattccca agggctggcc gatgacgcgc       180
     aaatgcgccc atgaggtcgc gatgcaggaa gccttcgagg aagccggcgt ccgcggcgcg       240
     gtcgaaacgg agacgctcgg cgcctacacc tattcgaagg cgttgcgcga cggggtgcag       300
     gtgatctgca aagtgcaggt ctatgcgctc gaggtcaccg acatggcgaa gaacttcaag       360
     gaaaaaggcg agcgccgcat cgaatgggtc tcgttcgacg aggcggcggc gcgcgtgcgc       420
     gaaccggagc tccgccacct tttcctcgcc ttcaagcaaa agatgaccga caggctttcg       480
     gccaaggcgg cgaagcaaat tccagacgtg aaacaaattc cggcggaatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page