(data stored in ACNUC7421 zone)

EMBL: CP001622.PE483

CP001622.PE483       Location/Qualifiers
FT   CDS_pept        511527..512435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0489"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54795"
FT                   /db_xref="GOA:C6B2H5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54795.1"
FT                   /translation="MIHHDFVNVVPMRLPPLNAIRAFEAVCRHGSILKAAEELNVVRAA
FT                   VRQQIDTLENHFGSKLFLRDGRRLVPTLQASAFAAAASAAFDILQRAASELEGAVPRRI
FT                   RLGVPSAFAVWWLMPRAADMQASLGDTVDIVPMATVEPLQMHLELDAVIMGGEYRPAAG
FT                   ITALRFMADEFGPVATPSLGATLSSDPAAMGTQTMLISRSVPKLWDEWFAESGTPPVVF
FT                   SRTQEFADLLLALGAARSGLGIALAPRASIEDDLERGHLVAPYGFISRPSGYNFCCRTP
FT                   DVKRPAFAALSGWLLRCGTPA"
     gtgatccacc atgattttgt gaatgtcgtc cccatgcgtc ttcccccgct caatgccatc        60
     cgcgccttcg aggccgtctg ccgtcatggc agcattctga aggctgccga agagctgaat       120
     gtggtgcgcg ccgccgtgcg ccagcagatc gacacgctgg agaatcactt cggtagcaag       180
     ctcttcctgc gcgacggccg caggctggtc ccgaccttgc aggccagcgc ttttgcggcc       240
     gccgcgagcg cggctttcga cattctgcag cgcgccgcgt cggaactcga aggcgccgtg       300
     ccgcgccgca tccgccttgg cgtaccctcc gccttcgcgg tctggtggct gatgccgcgc       360
     gcagcagaca tgcaggcgag cctcggcgat accgtcgaca tcgtgccgat ggccacggtc       420
     gaaccgctgc agatgcacct ggaattggac gccgtgatca tgggcggcga ataccggccg       480
     gccgcaggca ttaccgccct gcgattcatg gcggatgagt tcggtccggt cgcaacgcct       540
     tcgcttggcg cgacactatc gagcgacccg gcggcgatgg gcacgcagac gatgcttatc       600
     agccgcagcg ttccgaagct ctgggacgaa tggtttgccg aaagcggcac gccgccggtc       660
     gtcttttccc gcacccagga attcgcggat ctgctgctgg cgctgggtgc cgcccgttcc       720
     gggcttggca tcgcacttgc cccacgtgcc tcgatcgagg acgatctcga gcgcgggcat       780
     ctggtcgcgc cctacggctt catctctcgg ccatcgggct acaacttctg ctgccgcacg       840
     ccggatgtga aacggccggc ctttgcggcc ttgtccggtt ggttgcttcg ttgcgggaca       900
     ccagcctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page